HOME > FUNGAL CYTOCHROME P450 DATABASE > LIST OF P450 CLASSES > DETAILED INFORMATION OF P450 CLASS > DETAILED INFORMATION OF P450

Fungal Cytochrome P450 Database

Detailed information of P450

P450 name

P450_Fs005

Class name

E-class P450, group I

Species name

Fusarium solani f. sp. batatas

Sequence name

fgenesh1_pg.sca_20_chr6_4_0000622

Length

467 aa / 1,401 bp

Amino acid sequence

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
401
MALLSVPILAGALLAAVIVHNLLRVFTSPLSKIPNAGFGAAYSRLAWAFPREYKGTVTIDLPKLHEKLDPEQHAKRRRIMGQLFSRTKVPQLEKLISSHV
DRFVQLIRENGPNVDLAVASRALEADIMSTFSFGKSIEAVDSWASGKELEMVAKNDLKATWMPVLTNFPLLCELLEQLEGAIFRVTGVRSAYTKGLTEFQ
QWCRDSWKLAISEDSELDEPATKSPNLIKSLCNSGLHAETALSEAKENLGPGTDTTSATLAHILWALAQNPDYQNALYEDLAAVSFYTDMTTLESVPRLQ
ACVKEGIRWAGAAAAMLPRIVPPGGIELHGKFIPEGVREQTVLTSSPIWYQHDKTAFPNPKVYNPYRWLTDDCKGMSEDKLRDRFYIPFSRGANICMGAH
FAYLELYISVSQVIRNFHLEICNITQRSTLEKNEETNWTPVPLPKRREWVAAVPMEKLEVKMCPRL

Motif Information

Comment

There is no comment.