Fusarium Genome Browser

Detalied information of a protein

Locus name

FOXG_00002

Gene name

Protein name

conserved hypothetical protein

Species name / Reference name

Fusarium oxysporum [Fusarium oxysporum PROTEINS]

Position of protein

supercontig_2.1 of Fusarium oxysporum f. sp. lycopersici: 1771 - 2420

Amino acid sequence length

199 aa

Amino acid sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
MMPQMTGALQGQVAPPGQSLSEITQARLQQQYTAQMQQQQAPQQMQPNMTGFPGQQGPGLMSFPTGAGQFMQPMMTGMQGPNQFVPMQAQPTGFQPPFPA
TQSMYGAPTGGINSYLPPALEPQRTGMPGLQPQATGMTNMGGIGGMNNVQVPQPLQPQQTGPPPPVRFGVTNETKKLAPQATGRRANLAQATPQNPFGF

Gene sequence length

598 bp

Gene sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
401
501
ATGATGCCTCAGATGACAGGTGCTCTGCAAGGCCAAGTTGCACCTCCCGGCCAGAGCCTGAGTGAGATCACACAAGCCCGCCTGCAACAGCAATATACGG
CTCAGATGCAGCAGCAGCAAGCCCCTCAGCAAATGCAGCCCAATATGACTGGATTTCCAGGACAACAAGGCCCTGGCTTAATGTCTTTTCCCACCGGCGC
TGGACAGTTCATGCAGCCCATGATGACAGGAATGCAGGGACCGAATCAGTTCGTCCCAATGCAAGCTCAACCCACAGGTTTTCAACCGCCCTTCCCCGCC
ACGCAGTCGATGTATGGAGCACCCACAGGAGGTATCAACAGCTACCTGCCTCCAGCTCTTGAACCCCAGCGAACAGGTATGCCAGGCTTGCAGCCCCAAG
CTACTGGCATGACGAACATGGGTGGCATCGGTGGTATGAATAAACGTACAAGTCCCTCAGCCTCTGCAACCACAGCAGACTGGGCCACCCCCTCCCGTAC
GATTTGGCGTGACAAATGAGACCAAGAAACTAGCGCCTCAGGCAACAGGGCGTAGGGCTAACTTGGCGCAAGCGACCCCCCAGAACCCCTTTGGTTTT

Genic sequence length

650 bp

Genic sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
401
501
601
ATGATGCCTCAGATGACAGGTGCTCTGCAAGGCCAAGTTGCACCTCCCGGCCAGAGCCTGAGTGAGATCACACAAGCCCGCCTGCAACAGCAATATACGG
CTCAGATGCAGCAGCAGCAAGCCCCTCAGCAAATGCAGCCCAATATGACTGGATTTCCAGGACAACAAGGCCCTGGCTTAATGTCTTTTCCCACCGGCGC
TGGACAGTTCATGCAGCCCATGATGACAGGAATGCAGGGACCGAATCAGTTCGTCCCAATGCAAGCTCAACCCACAGGTTTTCAACCGCCCTTCCCCGCC
ACGCAGTCGATGTATGGAGCACCCACAGGAGGTATCAACAGCTACCTGCCTCCAGCTCTTGAACCCCAGCGAACAGGTATGCCAGGCTTGCAGCCCCAAG
CTACTGGCATGACGAACATGGGTGGCATCGGTGGTATGAATAAACGTACAAGTCCCTCAGCCTCTGCAACCACAGCAGACTGGGCCACCCCCTCCCGTAC
GATTTGGCGTGACAAATGAGACCAAGAAACTAGCGCCTCAGGCAACAGGGCGTAGGGCTAACTTGGCGCAAGCGAGTACGTTGAAACGATTTCACCTGTA
TATGTGTAATGCTAATGTTCTCTATAGCCCCCCAGAACCCCTTTGGTTTT

Range of contig sequence

-

Contig sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
1801
1901
2001
2101
2201
2301
2401
2501
2601
2701
2801
2901
3001
3101
3201
3301
3401
3501
3601
3701
3801
3901
4001
4101
4201
4301
4401
4501
4601
4701
4801
4901
5001
5101
5201
5301
5401
5501
5601
5701
5801
5901
6001
6101
6201
6301
6401
6501
6601
6701
6801
6901
7001
7101
7201
7301
7401
7501
7601
7701
7801
7901
8001
8101
8201
8301
8401
8501
8601
8701
8801
8901
9001
9101
9201
9301
9401
9501
9601
9701
9801
9901
10001
10101
10201
10301
10401
10501
10601
10701
10801
10901
11001
11101
11201
11301
11401
11501
11601
11701
11801
11901
12001
12101
12201
12301
GTTTCCTACTCGAGGTATCCTTTAATTGCGCCGCCTTCCCTCGGCTCATTTAAAGTCTTTGTTCCTCCGCATTCTTTTGTTCCCGGCCCTTTCTTTCTTG
CTCTTTTTGCTGGGTTCTCGCGAGCACAAACCTCAACCGTTTTGCAACTCCAATTCATTCCGCCAGCATGAAAGATCCATTTCCTTTGCAGCCTTCGCCC
TGGCTATCAGAAAAGACACAGCCCTGGGCCGACTATTTCGACCTGCCTACTCTCCCGCTGCACATACACGAAGTTCTGGCCGCAGCGTTGTTATACTCGG
TCATCTTCTGGCCTATCTCGCCATGGATCTCAAACCTTCTGGCCCCGGAGCACTACTCTAAGCTTCCTCGCAAGCGACGGCTCAACTGGGACGCCCCACG
TTGTTTCCATGGTTCAGAGCTGCCTAATCAATACCCTGGCTATATGGGTAATGTTCGTCGATACTGAGATGAGCGACATGGAATGGGAGGAGCGTATTTG
GGGTTATACTGGTGGTGCTGGATTCATCCAAGCGCTTGCAGCTGGATACTTCCTCTGGGATTTAGTAGTCACCAGCATTAACCTCGATGTATTTGGCTTG
GGAACCTTGGCGCACGCAATCGCTGCATTACTTGTCTACTCGCTCGGTTTCGTAAGTTAACCACGATGGCATGTCCCTCTATCTCTACTAATCAGCTTTC
ATCAGCGTCCATTTCTCAACCACTACGCCTGTGTCTTCATCCTCTGGGAGTTATCCACACCCTTTCCTCAATGTTCACTGGTTTATGGATAAAGTTAACA
TGACTGGTACACGCGCGCAACTATACAACGGTGTCATGCTTCTTTTCACATTCTTCTCCTGTCGGCTTATTTACGGAACTTATTCGTCCTTCCGTGTTTA
CCGCGACGTGTGGTCCGCCATTAATATTAACCCCGACATGAAGGCACTCAATTTGCCAACTATGTCATTTGCGCACCCAGACTCCACGGTACCCATGTGG
ATTGGCGTCGCCTATTTGGCCAGCAACGTCACGCTCAACAGTCTTAATTTTTACTGGTTCTTCATGATGATTCGCGCCGTACGTAAGCGGTTTGTGCCTG
CGGCTGAATCAGAGGAAAAGGTTCAAGAGAGCCCAGTGACTGAGGCTGAGATTGACCTATCTTCCGTCTCAACAGGTTTATCAAAACCCACTAGCGGTCG
TCGCCGCAAGGCTTGATCGGCTCAGGAAAGCCAGCGGGTCTAGTTGCCTCATATTCTAAGACGTTTTCGGGAAGCCCTTCTTGTTGGTCGGATTTGTTGT
CGGCTGAGAGCTCGCCTTCGAAAACATTCAGACTGCTCCCATCACTTACCGAACAAGGATGCTCAAGTTTCAATCACTTTAGACCATGAATACAACTCTA
TGGAACGGAAGAAACCACTCGATCTTTTTTCTCTCGTTTGATCATCTTATCCCTGTGGCCCCTTTTTCGATTCCATCGCATTTTGGTATCACACATCGCC
AGTTTGCAACGAGACCTCGCTTCGTCAATGATTTACGTTCTGTTACGACTTTGTATAGACTTATAGATGAGAACGTTAGAAGAGACTGATCTGGCTTGTC
CAGGAACAGCCATAAATATACCATTATTATTCCACACTTGACTCCCAGGTTGGTTGACCTGACAAAGTCTACATATACATACAAGATGTGAAGAAAGATG
TCCAGAGTATTTGCAAACATGACGAAACGACGTGCGATGACGACCAGTTTAACAAGCTTTTCAAGAATTAAAAACCAAAGGGGTTCTGGGGGGCTATAGA
GAACATTAGCATTACACATATACAGGTGAAATCGTTTCAACGTACTCGCTTGCGCCAAGTTAGCCCTACGCCCTGTTGCCTGAGGCGCTAGTTTCTTGGT
CTCATTTGTCACGCCAAATCGTACGGGAGGGGGTGGCCCAGTCTGCTGTGGTTGCAGAGGCTGAGGGACTTGTACGTTTATTCATACCACCGATGCCACC
CATGTTCGTCATGCCAGTAGCTTGGGGCTGCAAGCCTGGCATACCTGTTCGCTGGGGTTCAAGAGCTGGAGGCAGGTAGCTGTTGATACCTCCTGTGGGT
GCTCCATACATCGACTGCGTGGCGGGGAAGGGCGGTTGAAAACCTGTGGGTTGAGCTTGCATTGGGACGAACTGATTCGGTCCCTGCATTCCTGTCATCA
TGGGCTGCATGAACTGTCCAGCGCCGGTGGGAAAAGACATTAAGCCAGGGCCTTGTTGTCCTGGAAATCCAGTCATATTGGGCTGCATTTGCTGAGGGGC
TTGCTGCTGCTGCATCTGAGCCGTATATTGCTGTTGCAGGCGGGCTTGTGTGATCTCACTCAGGCTCTGGCCGGGAGGTGCAACTTGGCCTTGCAGAGCA
CCTGTCATCTGAGGCATCAT
GGGGGGAGGTGCAAAGCCGCTGGGCTGGGCTGATTGCGGGGCTGAAAGAGGTCGCTGAGGTGGTGGAGGGACGAGAGAGC
CCTGGTTCGCAGTACCTTGTGGGGGAGTAGGACGTTGCCGAGCCTGAGCAACAGATGTAAAGAATGAGGGGGTAGCGCCGCTCAACGGTTGCGGCACGGG
TGTCGAGGTCGGCTGAGCAGCGATGACAGGCGCCGGTGCCGGGGCGGGTGCTGGCTCAGCCCTGGTGGGTTCGAGGGGCGTTGAGAGGAGCGACAACTCT
TGCATGGAGCCAGTCAAGGCCGGGGGAGGGGGTGAGACAGGGGCAGGCTCAGGGGCAGGCTTCTGAGCAGACTCAACAGCAGGCTGAGCTTTAGGCGGCG
ATTGCTGCTTGCTAGGCTTCACGTCCCAAGCATCATCATCGAATCCTGAGCTCGCTGCTGGACGAGTTTCGGGACTCTTATTCGTAGGACTTGTGGGCGG
GGGTGACCTGCTGTCGTTCTCACCAGTCTTGGAGGAATCACCTCGTGAAAAGGCACTGGCATCAACAACATCACTTGTTTGGACTGCTGGTGCGGGTCGG
CCCTTGCGGGTGTTGTTTCGTAGCGCACCGCCAGGTCCAGAGAATAAACCCCCTTCACCATCAACTCCATCAGCAGTTCCTCTCTTTCCACCGCGGCTGC
GACCATATTTGGCATCCAAGGTACGCATGACCTTGATGATATCACCTTCGCGAATTCCAAGGGCTCTCAGAGTGGTGGCGTCGACATCAGGAAGCACGCT
CTCATCCATGGAATCCTTGATAAAAGCTTGTGCATAGCGCTCACACAAACCCACTGCAACCTCGCAAGACAAGAAAAACTGAAACCAGTCGTAGTCGGAC
TTGGCATCCTTGTCGATCGTTGCGCCTGCTGAAGGACTACGTTCGGGGGATTTCTTTTCGGCAGACCGAGCTCTCTTGACATCTGCCAACGGCTTATCGT
CTTCCAGGGATATGCCTGTGAAGTTTTCAACATACTCGAGATCCTCGCGCGACATTTTTGTGATAGGAACTGCAATCTTGACACCATTCATCTTATGTAA
GTGAATCTTCCCGTCCTTCAGACCAAGGAATTGGGCTTCCACACTGAAAGACCGGGAACGGTCTGTCCAGGTGCGCACCTTGGACGCGTCAGCTCTATAA
AACGCATGTTAGCAGATGCTCTAAGTCCTATCGCAAACATCTGAGTGAAAAGAGAAATCTAATCAAGTGCTGACTTACTAGACTTTGATCGGCTTTGACT
GCCGCCATCACTTCGTCCATTTTCTCGACGGCTCCGCTGTTGTCCCGAATTACTACCAGTTTCTCTTGCCATGAGGCTACTGCCTCGTTCAAGGGAGAGG
CATTCCCCGGTCCTACCTGCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTCTGTTGCTTAAGTATAGAGAAATGATAAAAAAGACAATTAGAGGGGGTTGGCTAGAAG
TAAGACGCTACGATGCGATGCGATGCGATGCGAAGTGACGCAGTGGGTCGTTTGTCTGAGGAGCAAGCGATGGACTACCTTGGTAAGGCAAGTATGGACC
GATCCGACGTACCGTACCTTCCCCCTACCAAGTTCATTAACCAGAATCTCTGATTGCGGTATAACGTGGGTGGGTGTAAAATGCGATCCACTATGTGTTA
ATTCGTTGGTAGGCGGATTGGGTCGCCAGAAGCGGAGCATTGCAGGTACATATTGTGCGTCACCCCTTTATCTGGCGCAGGTTGGGCTTTAAAGTAACGT
CAGCTTAAAGCTAAGCACTCAGCGGGTAATGCTACCCTGTATCTTGCACGTGAGTCGAGATAGGCCATTTGAGCTTCACTTATCCCAGCTGCCAGATTAT
AGAGTAAGAGAAGTTTAAATAAACTATCAGTGATAATGATTGATATCTTTTTTAGGTCCTTAAGATTTTTATGTTTTTCTCTGCCACAAGTTGAAGCTCA
ATGATTAATATTAAATGCCAAAAAAAAAAAAAAAAAAAAAAAAAAAGAAGCGAACATGCTAACATTTCAACGAAGCCTAATCACCACACAGAACGATCTT
GCTGATTGTTTAGATACATTATATACCTTGTTATCACATAACTTTCCCTAAATCATGCCAAAGCGAGAGCAAATACTCGATTACTTAATCCACATGCGCC
GTTGTCTATCCACACCTGTTGGGTGTCCAATTGTTCATCCATTCCAATACCTAAAGCAATTCTATTCACAATGTTCAAACAGTTACACATCTAAATACAC
GGCCGAGACTAGCAAAGATCAGGTTTCGGGGCCGAAAATATCGTCTTCAGTGTCACGGTCGTCACTGGCTTGGGCAAGATTCCGATGGCTACCTGTGCGG
TGTCCACGAGTAAAAATGCCTGGGAACATTCTCGGGTCGGTTCCAGAGAGATGATGGTCCGACATAGGATCACTGGGCCATGTTTGATCTCGGCCGGCCG
ACAGACCAACCTGGGATGCGACCTTTGCAATGTGATGGCCAACTGGTGAAGACGTCTCGACATTGGCAGTCTCATTGCCCGTTGCGACCCCCAAACCAGC
GGTTTGGCCATCCAGGGACGCCACTGACTCTGACATCTTGCTCTCATTTCCAGCAGCTTGCACAGGAGGCTCATTCGCAGCATTATAAGTGACATATTTC
GACAGCCTGGGAACAATCGTTAGCATAAAAGTGATCGATCATACGGAAAGGGCCAGCCGCTTACACGTCTCTCTCCTGCATCAAGGTGAAGTAGCGGAAC
TCTTCCCTTCGATCAGGAACATTTGTCTTAACCATGGCATTTCCTTCCTTTCCTGGCTTATTACAGCCACGCCCTAACCAATGCTCCTTGATGGCCAACT
CGTAACCGCTTTGTTTAACAGAGTTCTTGGCGAGCTCACACATGTCGACCGAGTTCAGCTTGTAAATCTGTGCCGCAACTGCATACTCCTCGATTAATGG
CTCCTTGGTGAAAGCAAACTGTAGAGGATCGTCCGTAGATAGTGAGACATTGAGACCTCTCTTGAAGTACTGGTGGAAAGGGTTCCGCTCATAGGCGAGG
AACAGGGCATTGTTACTCAGTGGTGACATGGCGATGCCGATTTGGTCCAGATAAAAGATGTACTGAAGAAGGGGACTTTGCGTAGGAGCAGTCCGTGACT
GATGCTATGACAGCACAAGGCGGCAACAGCCAAGTGCTCGCTGTCACCAGCTTCTCCGCAATGGGGTCGCAGGACCAGCGTGTTGAAACCGCGCTTCTTG
CGCCAGTAATTCAACGACACCAGATTAGAGTAGAGATAGTAAATCCAGTAACTATATGGCGGGTTCTGTTTGGTATCCCATACTTTTGGCACAGGGAACT
TCTTGAACAGCCGACGCTCGACTTTACTCTCGTCGTCAACACTGTCGAAACCAATCACTCGCTGAAGGAAAATATGCAGCTTGGGATGGCTTAATGGGTC
CTTGGTGACTTCAAAGAGTGGCTGAAAGACATTCTTGACCACTTGTTCAAACGTCTCCATGAGACCACTTGCTTTGTAGACGTCGTAGAGGCGAGGGATC
TGGATGAGCCAGCGGACATTGTGCGAAAACAGCTTGTTATCGACCACCCAAGCGGCAAGCTTGTCCCACTCATCGATCGATTTGCCATAAATGGAGATGC
GCCACTCAACCATTTGATACTTGCTTGACTCAAGATCAGATATGACTTCCTTGGTAATTTCGGCAAGGTACCGGCCGTGGATAAAGTTATCTGTTTTGAG
GAAGATAGTTCGAAGACGGGACTCTCCGACTGGATTATACTTGAGATTAAATTTGTCAAAGCGATGGAACGAATCCGTATGAGCCTACAGCAGTTAGTGA
CTCAATTCTCTAAATACAATATCGAGTTCAGAGAGCAAGCCTTACATGCATGTCCAATGTATCAATGCTCAGGTCATAAGCTGTCAGATTAATACTAGCA
AAAACCTCGGCTAGAGTGAGATGTCTTCCATCGCGGAACAGGACGACTTCGTTGGGAAATTTCTTCATCTTACTCTTAATGAAGCGAAGCAGATGTTTCT
GGTTCATGCACGCAGAATGATGAACATGAGTATCTACCTTTCGAACATTGTAAAAGTCTCGGTGGGGAACCTTCTTGCTGTCGGCTGTTTCTTGATACTC
ATTCAAGAGGACATAGAGGTTGAATTTACCCTCGAGATATTGGAGACGTCGAAATGCAAAACTCTTACTAGGTCCGTCAGATGAGACATCCAGAATGTCG
TCCAGGTCCATGTAGAATTCCCTGATTGTAGGAACCTTGATCGCAGGCGTCTGAGTATCGTGGCCTTCGAATACTTGATAGACTCCGCTATCATCCAACT
TATATGAGCGTCCATCATCGCCCGGCAGAGGCAATATGTCAGCCATATCGAAATCCTCTCCAATATCTTGACCTGGCTTTCGCCTTCTTGCCGAGCGTCT
ACCCTCATGGTGCTCCTGGGGCAACTCTCCTGGTGTGGACCCAGTAGCATCCTTACTACCGTTCAACCCAGTATTCTCTTGACCTGGTACGTGCTCTGTA
GTACTTGCTCTTTGCCTCGACGATTGCTGCCATGCCGGCTCTGGTGGAGGGGGGTAAATTTCCCAATCCGGGCCGTCTCTTGGGTTATCATCAGGCCCCT
GATTCGAGAGGGCGATATATTTGCGCCTGGTGTCGAGGATTCTCTGAATGTTTTTCGAGATAGCACTCAATTCTGAAGTGATATGGGGCTCAGTGTCGAA
GAGTCCACCAGAGGGCAGGCCATTGCTGGAGCCATCAGGTAGCCGTGGATCCTGGGCAACCTGACCAGCATGAGGAAGAGCAGAAGGATGACTAGGCGGG
AATGGGGCAGGTTGCGCATTGAATTTTGTAGGCGATTGAGTAAACCCCGAGTCAACGGCAGGGTTTGGCATCTCCAAGCCAGGAGGGAAAGACTCGACTC
GACGACCACTCGAGTCTAGCACAAGACTATCGGCACCATATTCGGTTGCAGGGCGAGACCCAGAAGCAAGGAAAGGACTTTGAGGTATAGATTGGTAGCC
AGCCCCACCACCGCTTCGTGCATCGGCCTTGTTTCGGTGGTAGAAGTATTTTGCGTCCGTCTGGCTCATTTGACGCTCAGCGACAGGATCGTAAAAAGTC
GTTCTCTTGGGCAAGTCGCGGAGAAGCATTCCATCTTCGAGCTCCTCAGCTTCGTTGCCGGTGTGGGAGCCAGCGTCAGAGGGGGCATTGTGCGAGGCGC
CATGTCCGGTTGCACCAGAATCTCTAGTCTCGTCTATCTCCTCATCTGACTCCCGTGCCCGCACATCAAGCGCGCTTGATTCGCTTTCCTCAAAGATAGG
GCCGCCTGTGGCATATTCTCGGTCAGAAATGTTTCCAATTGCTGTCGTTATCATCGAGAGCCAAAGCAGGGTTCGTGATATTGGGTCTGGCGCAGCGGAG
GAGAGGCAGGGCGAGCTGTAGAATACGTACCAGCCATGGCGATGCCTTGATCTGAATACGATTTAGCTAGCAGATCAAGTTCCCTCGATTGTGTAAATCC
TCCCTCGGATGATGACTTTGAGGATGGTGATTGATTCGATTTTAATTATCGAGAGGACGTTTGAAAGAGGAGAGCACTAGGAAGTGCGCCCGCAATAAGA
GAGGCAAAGACAGAGACAGCCCTTGAAGGGAAGGTATGACGGTGTGACACACCAGGGTTTATAGCGGGTCATAGCGGGACAATGCGTCGGTGCAATGCAC
GCCGTAGGCAAGGCGGGGGGGTAGAGGTCCCCTCTAAACTCATTGAGGCATCTGCTCGGTATTGAGTTAAAGCTCCACATGATAGTTGCTTCTTGGAACC
TCTCTATACTTAAGCCTTACCGGATGAAGGAGGTGTTGTGCGCCTGTTTCAAGATAGTAGTGGTTTTTCTCCATATCGGATATGCATATAAATCTCCTCA
AAGCAGAATATTCTTCGAGATAGGGCTCCGCAGAACCGGTACCCGCCGTTCTCCTACAAGACAGGGGTCTCAACTTAGAACACCAACCTTGACTCAATAT
CCAACTAGAGATATGAAGCCTCGCTCTTGGAAGAGCTGCAGTCACCCGATCTCAACGTTGACTTCTCAACGATAAGATCCGCAAGTCATGATTGTTCCTA
TCAACTGTAAAGTATCAAGATGCAGATTGGGTCTGGCATCTTGTGAGGAATAAGGATGCCATTAAGTATTATTCTCCTAGAATCGAATACAATCATATTA
ATAGACAACGTACTTTCACAGTCTTTCAGAGCACAGTGAGACACTAAATTCGAACCACAAGCTTAATCACGGCTGACTTACCAAGTGTCGCGAATCCCCT
GAAGAATCACCTTACCTCTGCCATAGCATAGGCTCATGAGAATATTAGTAACCGAATCACCGCCAGCTCCACTAAATTCGGAAACACGGGTGCTCTACCG
TGTTACATGGCCCGTTGCCGCAACCGTAGTACCGGGTCAATCCCTGGTCTTGATAGAGGGGACCCCTAGACGAGGAGATTTTGAGGCAGTAAGAGTGATA
GGGTAAGTGCTTTGGGCATTGGGTTTAAAAATCGTATATCTACGCATTAAAGCAATATGAAACCGATAATGGCATTACTTTCCGCTCCTCATTCTTGGCA
TTTTCAAGCTTGATAGGGGAGTGTAAGTGAATCACTACAAATGCATATGTCATAGATTTAATCACACTAAGAGGCAGCTTCTCAAGACAAAAGAAGGTCG
TTTTTCAGAGAGCTATATGTATTATCCAAAACTCAATGTTATGCGTGTATTGAGTGTTATCTCGCGACACACTCGAACGGGCAACGATATCACTCAGCAT
CAGTCACAAGTCATCGGTCAGGCCTCAGGTGAAGATGAAATGAAGAAACCCGATAGTCTTCTCCCCTTGAAGTCATGCTTATATACTTGGCCCTTAGAGA
TCCACAGTCAGAGTCTCTCAGGGAAAAGAACCCCTGGCTCGGTGCCACCGTTTGATAAACCAACCCTCATCTGACCATCCCCTCCCCTGTTGGCTCTGAA
ATAGTATGGAACAAAAACCAAATTCACAGACTCAGCAGCCTCTAGCGATAGTGATCCAAGTGCTGAAGGTGACTGCTTCCACCCTTGAGCTTGCATCGCG
ACATACTCTTCGCCGGACGCTTCATGGACCACTTTCTCTTCAGTAACCGACGAGTCCGTTCGAATGAATACATCCTTGAAATGATTAGACTCCGAGGGGT
TATCGACATCTTCGACACAATAGACGATTGGCCCTCGTGCGAGGGATAAGTTGCGTTGATTTGAGTAGGGGTGGGGTGATATAAATCTTGGTTCGAAACC
ATGAATATCTAGCGAGAACCGAGGATTTTCAGAGAGATAGGAAGGCCGTAGAGATATATAACCCTTTTCAACCTTTGAGGTGGTCAAATTTGCTGGTGGG
TATAATGTAAATCTTCCTTTGGACCAAGCGGGCAAACGAAGCCGGATGGTGGTTTGCAAGAAAGATGGAGACGACAACTCAAAGTCAACCTTGCCCTCCC
ACGGCCAGTTGGTCTTTTGCTGGAGCGTGACAATCGAGTAGCCTACTTTGAATTGCAACTCGGCACCAGTGTATAAATGGACATTCACAAAGACGCCATT
GCCCTCAGTACCATAATCCCAAAGATAGCCGCCCAAACTGCCGAATAGCCTCGTCAAGTTTGGAGGGCAACAAGCGCACCAGAACCACCCCTCACGCATG
TTTTTGTCAGTTTCAGAGCTGGCAAGTTGGTTGATGTAAGTGAAGGATTTGCCATCCAAACTCATGGCTGTCATGATGGTGTTGTAGAGACATAGCTCGA
TAATATCGGCGTATCGAGAATCGAGATCAAGGTGTAACATTCGTTCCGCGAGCATGACGAAAGCAATCGAAGCGCATGTCTCAGCATAGCAGCCTCCTTC
ATCCGTGCCCTGGGGAAGGAAGTAATCAATTCCAAAGCCCTCCCACTGTGCCATAGCACCGATGCCTCCAGTCAAGTACATCTTCCTATCAACCATGCTG
TCCCACAGTCTATGCAGTGCCTGTGACCATGCTTCGGCATCAGGTAAAGCCTTTCCACTCTCTGCAGAGAGATGCAGCATGTCAGCAACAGCAGTTAGAA

Favorite :