Fusarium Genome Browser

Detalied information of a protein

Locus name

FGSG_00011T0

Gene name

Protein name

conserved hypothetical protein

Species name / Reference name

Fusarium graminearum [Fusarium graminearum 3A PROTEINS]

Position of protein

supercont3.1: 48092 - 51188

Position of transcript

supercont3.1: 48092 - 51191

Amino acid sequence length

719 aa

Amino acid sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
401
501
601
701
MAIKAIVIVAGVGPGTGSAIARKFGAAYSIALLARKRENYEGLVKEINERGGKAIGFSTDVSSEESIKAAFSNIHKEYGNAPIATAIFNALGIFLKKPLL
EISVDKFGASWQVSCKGAFILSQATLPGLLRQATDINTLHLPTLIFTNTTAAIKANARVSANNLLYNLKHRPICLSAIADLKRVEQFLHLLEILARNPTT
VTRSRRRGFSVRILGFPAIALFACVIYLTFTPACYNIRTTVAWHLALMKPVKCCTTCRRRHRRCVTQPGASQCSTCLESGQECQFDNDIRFKHSHSKTEK
QSRREWAKVPSKTPRGIDGMVLEESGSNSTKDEAAKNLSQTAQIPEEMIEVSVNDLAQSGPQVVPLNPELDYRKSASNFIANSLVDDPSVRDSDEYFDHA
TAQDLPVQVHISSPYELTEREAFLFMIYIYKCAPLSDACDDARHFELEVPRLALRQPMIMNGLLALASRYDSRCMDTSNDIESTFYHNKCIKLLIEAFAQ
PPETWDSTLLTAVVIARLYEENDNETDSYYHHLSGTQNLLNHEAVARFVIQGGLAEAASWVHLRQVIYIYVVRRRPIEICLESFERSTVFRRCDDSAYAN
RAVYNFAKIMRLFLQVENLDSDQDEWQAAEMEVDRWYDAKPVSFQPVFHILADLSANRPFPTLYFIASVPGGYCIRDPCEQTHAICYLEKVNEVIKWKTK
ELIATLKEKWHDGEKHDSH

Gene sequence length

2157 bp

Gene sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
1801
1901
2001
2101
ATGGCTATCAAGGCGATCGTCATCGTCGCTGGAGTTGGCCCAGGTACGGGCAGTGCCATTGCACGTAAATTTGGTGCCGCCTATTCAATTGCGCTTCTGG
CTCGTAAGCGAGAAAATTATGAGGGCTTAGTAAAAGAGATAAATGAAAGAGGAGGCAAAGCCATTGGATTCAGTACAGATGTATCTAGTGAAGAGAGTAT
AAAGGCGGCTTTTAGTAATATTCATAAGGAATATGGAAATGCACCAATCGCTACGGCCATTTTCAATGCTCTAGGAATCTTTTTAAAGAAGCCTCTATTG
GAAATAAGTGTGGATAAGTTTGGAGCATCCTGGCAGGTGAGCTGCAAAGGAGCATTCATCCTTTCGCAAGCTACTCTTCCTGGACTGCTCAGACAGGCCA
CAGATATTAATACACTGCATCTACCGACTCTAATTTTCACGAATACAACTGCAGCCATTAAGGCAAATGCGCGAGTGTCTGCTAATAACCTACTCTACAA
TTTGAAACACCGTCCTATATGTCTAAGCGCGATTGCGGATCTAAAGCGCGTCGAACAATTCTTACATTTACTAGAGATACTCGCCAGAAACCCAACCACG
GTCACACGCTCTAGGCGGAGAGGTTTTAGCGTACGTATCCTTGGCTTCCCCGCTATTGCCTTGTTTGCCTGTGTTATCTACCTCACATTTACGCCTGCAT
GTTACAACATCAGAACTACAGTCGCTTGGCATCTTGCACTTATGAAGCCAGTGAAATGCTGTACCACTTGTCGCCGCCGACACAGGAGATGCGTCACTCA
GCCGGGAGCCTCTCAATGTAGCACTTGCCTTGAGTCAGGGCAGGAATGCCAATTCGACAATGACATTCGGTTCAAGCATAGTCATTCAAAAACTGAGAAG
CAGTCAAGGAGAGAATGGGCTAAAGTTCCCTCTAAGACACCACGCGGAATCGACGGTATGGTGTTGGAGGAATCAGGTAGTAACTCTACAAAGGACGAAG
CTGCCAAGAACCTGTCGCAAACTGCGCAGATACCCGAAGAAATGATAGAAGTATCTGTTAATGATCTTGCACAATCTGGACCTCAAGTTGTGCCCTTGAA
CCCGGAACTCGACTACAGGAAATCAGCTTCCAACTTCATCGCCAACTCTTTAGTTGATGACCCTTCAGTCCGTGACTCTGATGAATATTTCGACCATGCT
ACAGCCCAAGACCTACCGGTTCAAGTTCATATTTCATCTCCATATGAGTTGACTGAACGAGAAGCCTTTCTTTTCATGATCTATATTTACAAATGTGCAC
CCTTGTCTGATGCATGTGACGATGCCCGTCATTTCGAACTCGAAGTTCCCCGATTGGCCCTTCGCCAACCCATGATAATGAACGGTCTACTCGCCCTCGC
AAGCCGCTACGATTCTCGATGCATGGACACGTCCAACGACATTGAAAGCACATTTTACCACAATAAATGCATAAAGCTTCTTATAGAAGCTTTTGCTCAA
CCCCCTGAAACATGGGACTCAACGCTCCTTACAGCCGTTGTAATCGCGCGACTGTATGAGGAGAACGATAACGAGACTGATTCCTATTACCATCATCTCA
GTGGAACGCAGAACCTTCTGAATCATGAGGCAGTCGCTAGGTTTGTGATACAGGGGGGATTAGCTGAAGCTGCAAGTTGGGTTCATCTTCGACAAGTAAT
CTACATCTACGTAGTGCGCAGGAGGCCTATCGAGATATGCCTTGAGAGCTTTGAGAGGTCAACTGTGTTTAGAAGATGTGACGATTCAGCATATGCGAAC
AGAGCGGTCTATAACTTCGCCAAGATTATGAGGCTATTTCTACAAGTTGAAAATTTGGACAGTGATCAAGACGAGTGGCAGGCAGCTGAGATGGAGGTAG
ACCGGTGGTATGACGCTAAGCCCGTATCTTTTCAACCTGTATTTCATATTTTGGCGGACCTCTCGGCAAACAGACCGTTCCCGACCCTTTACTTCATTGC
ATCAGTGCCCGGTGGATATTGCATAAGAGACCCATGTGAACAGACCCATGCCATTTGTTACCTTGAGAAGGTTAACGAAGTGATTAAGTGGAAGACAAAG
GAACTTATTGCAACGCTGAAGGAAAAATGGCATGATGGAGAGAAACATGATTCTCAC

Genic sequence length

3097 bp

Genic sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
1801
1901
2001
2101
2201
2301
2401
2501
2601
2701
2801
2901
3001
ATGGCTATCAAGGCGATCGTCATCGTCGCTGGAGTTGGCCCAGGTACGGGCAGTGCCATTGCACGTAAATTTGGTGCCGCCTATTCAATTGCGCTTCTGG
CTCGTAAGCGAGAAAATTATGAGGGCTTAGTAAAAGAGATAAATGAAAGAGGAGGCAAAGCCATTGGATTCAGTACAGATGTATCTAGTGAAGAGAGTAT
AAAGGCGGCTTTTAGTAATATTCATAAGGAATATGGAAATGCACCAATCGCTACGGCCATTTTCAATGCTCTAGGAATCTTTTTAAAGAAGCCTCTATTG
GAAATAAGTGTGGATAAGTTTGGAGCATCCTGGCAGGTGAGCTGGTAAGACGCGCTTCGTAATGAAAGCATCTAGCTACCTAGGCTAATAATAATCGACA
GCAAAGGAGCATTCATCCTTTCGCAAGCTACTCTTCCTGGACTGCTCAGACAGGCCACAGATATTAATACACTGCATCTACCGACTCTAATTTTCACGAA
TACAACTGCAGCCATTAAGGCAAATGCGCGAGTGTCTGGTAAGTTTAAGTTAATGTCTAAGACCTCGGTTGAGTATTTGTCTAACCCAATCTAGGATGCT
TATCCACTCTTTCTTCGCTGCAGCTAATAACCTACTCTACAATTTGAAACACCGTCCTATATGTCTAAGCGCGATTGCGGATCTAAAGCGCGTCGAACAA
TTCTTACATTTACTAGAGATACTCGCCAGAAACCCAACCACGGTCACACGCTCTAGGGTAGGCAAGGATAGCCGTGCTCTCTTTTGGTTCCACGTCGATC
ATGCCCTATGAGATCGAAGTCCAGCACGACTTAGGGACCTGAAAGTGCAACATTGATATCATCAGCAACCTAAGTAGCGGTGAACATGAGACGTACAGTG
CGATACGTAGTTGACTGCTTAAACAAGATTGGCTTTTGTTGCAGGGAAGCCTTGCTTCATGATGCTTTTCTGTTAATAGATAATTCTAGAACAGTGTCTT
CTAAAGCTCAGCTACCCTATGGCTATGACTTGTTGGATTATAGCCAATCACACAAGCCAAACTACCTAGTCTAGACTAGCGGAGAGGTTTTAGCGTACGT
ATCCTTGGCTTCCCCGCTATTGCCTTGTTTGCCTGTGTTATCTACCTCACATTTACGCCTGCATGTTACAACATCAGAACTACAGTCGCTTGGCATCTTG
CACTTATGAAGCCAGTGAAATGCTGTACCACTTGTCGCCGCCGACACAGGAGATGCGTCACTCAGCCGGGAGCCTCTCAATGTAGCACTTGCCTTGAGTC
AGGGCAGGAATGCCAATTCGACAATGACATTCGGTTCAAGCATAGTCATTCAAAAACTGAGAAGCAGTCAAGGAGAGAATGGGCTAAAGTTCCCTCTAAG
AGTAAGTCCAAAGCCTGCTTGGCCTCTGGCCTTCAACCTTTCTGTGTATTTTCATGCTGAAGGCTGTAGTCTCTTTCACAGCACCACGCGGAATCGACGG
TATGGTGTTGGAGGAATCAGGTAGTAACTCTACAAAGGACGAAGCTGCCAAGAACCTGTCGCAAACTGCGCAGATACCCGAAGAAATGATAGAAGTATCT
GTTAATGATCTTGCACAATCTGGACCTCAAGTTGTGCCCTTGAACCCGGAACTCGACTACAGGAAATCAGCTTCCAACTTCATCGCCAACTCTTTAGTTG
ATGACCCTTCAGTCCGTGACTCTGATGAATATTTCGACCATGCTACAGCCCAAGACCTACCGGTTCAAGTTCATATTTCATCTCCATATGAGTTGACTGA
ACGAGAAGCCTTTCTTTTCATGATCTATATTTACAAATGTGCACCCTTGGTAAGTTACAGCTGTCAGATGTCGTCTCCACTAACATGACATTTAAGTCTG
ATGCATGTGACGATGCCCGTCATTTCGAACTCGAAGTTCCCCGATTGGCCCTTCGCCAACCCATGATAATGAACGGTCTACTCGCCCTCGCAAGCCGCTA
CGATTCTCGATGCATGGACACGTCCAACGACATTGAAAGCACATTTTACCACAATAAATGCATAAAGCTTCTTATAGAAGCTTTTGCTCAACCCCCTGAA
ACATGGGACTCAACGCTCCTTACAGCCGTTGTAATCGCGCGACTGTATGAGGAGAACGATAACGAGACTGATTCCTATTACCATCATCTCAGTGGAACGC
AGAACCTTCTGAATCATGAGGCAGTCGCTAGGTTTGTGATACAGGGGGGATTAGCTGAAGCTGCAAGTTGGGTTCATCTTCGACAAGTAATCTACATCTA
CGTAGTGCGCAGGAGGCCTATCGAGATATGCCTTGAGAGCTTTGAGAGGTCAACTGTGTTTAGAAGATGTGACGATTCAGCATATGCGAACAGAGCGGTC
TATAACTTCGCCAAGATTATGAGGCTATTTCTACAAGTTGAAAATTTGGACAGTGATCAAGACGAGTGGCAGGCAGCTGAGATGGAGGTAGACCGGTGGT
ATGACGCTAAGCCCGTATCTTTTCAACCTGTATTTCATATTTTGGCGGACCTCTCGGCAAACAGACCGTTCCCGACCCTTTACTTCATTGCATCAGTGCC
CGGTAAGTGTGACTTTCAGCTGCTGTGCTCTCTCGCTAACATATCGGAGTCGTTGCAATGCAGTATTACTTCGCAGCCAAGGCCGTTTTATATTTGCATC
ATTGTAAGAACTTGCAGCAACTGAATAACCATGGAAGGCCAGACTTTGAAGTATTTTGAAGGACTACTCTCGTCAAAGATAACACACTAATTAATTGCCA
GACCAAGATATCCTTCTATCTCTTCACTCTCATGGGTCTTGCTCTATCCAACTCCCATGTTCTAAACGCATTTTACCTACCTGCACATATGCTTTCATTC
TGTACAGTCATCCCCCACCCCTAATGTGACAATGGCTGCTAACCCTTGTAGGTGGATATTGCATAAGAGACCCATGTGAACAGACCCATGCCATTTGTTA
CCTTGAGAAGGTTAACGAAGTGATTAAGTGGAAGACAAAGGAACTTATTGCAACGCTGAAGGAAAAATGGCATGATGGAGAGAAACATGATTCTCAC

Transcript sequence length

3097 bp

Transcript sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
1801
1901
2001
2101
ATGGCTATCAAGGCGATCGTCATCGTCGCTGGAGTTGGCCCAGGTACGGGCAGTGCCATTGCACGTAAATTTGGTGCCGCCTATTCAATTGCGCTTCTGG
CTCGTAAGCGAGAAAATTATGAGGGCTTAGTAAAAGAGATAAATGAAAGAGGAGGCAAAGCCATTGGATTCAGTACAGATGTATCTAGTGAAGAGAGTAT
AAAGGCGGCTTTTAGTAATATTCATAAGGAATATGGAAATGCACCAATCGCTACGGCCATTTTCAATGCTCTAGGAATCTTTTTAAAGAAGCCTCTATTG
GAAATAAGTGTGGATAAGTTTGGAGCATCCTGGCAGGTGAGCTGCAAAGGAGCATTCATCCTTTCGCAAGCTACTCTTCCTGGACTGCTCAGACAGGCCA
CAGATATTAATACACTGCATCTACCGACTCTAATTTTCACGAATACAACTGCAGCCATTAAGGCAAATGCGCGAGTGTCTGCTAATAACCTACTCTACAA
TTTGAAACACCGTCCTATATGTCTAAGCGCGATTGCGGATCTAAAGCGCGTCGAACAATTCTTACATTTACTAGAGATACTCGCCAGAAACCCAACCACG
GTCACACGCTCTAGGCGGAGAGGTTTTAGCGTACGTATCCTTGGCTTCCCCGCTATTGCCTTGTTTGCCTGTGTTATCTACCTCACATTTACGCCTGCAT
GTTACAACATCAGAACTACAGTCGCTTGGCATCTTGCACTTATGAAGCCAGTGAAATGCTGTACCACTTGTCGCCGCCGACACAGGAGATGCGTCACTCA
GCCGGGAGCCTCTCAATGTAGCACTTGCCTTGAGTCAGGGCAGGAATGCCAATTCGACAATGACATTCGGTTCAAGCATAGTCATTCAAAAACTGAGAAG
CAGTCAAGGAGAGAATGGGCTAAAGTTCCCTCTAAGACACCACGCGGAATCGACGGTATGGTGTTGGAGGAATCAGGTAGTAACTCTACAAAGGACGAAG
CTGCCAAGAACCTGTCGCAAACTGCGCAGATACCCGAAGAAATGATAGAAGTATCTGTTAATGATCTTGCACAATCTGGACCTCAAGTTGTGCCCTTGAA
CCCGGAACTCGACTACAGGAAATCAGCTTCCAACTTCATCGCCAACTCTTTAGTTGATGACCCTTCAGTCCGTGACTCTGATGAATATTTCGACCATGCT
ACAGCCCAAGACCTACCGGTTCAAGTTCATATTTCATCTCCATATGAGTTGACTGAACGAGAAGCCTTTCTTTTCATGATCTATATTTACAAATGTGCAC
CCTTGTCTGATGCATGTGACGATGCCCGTCATTTCGAACTCGAAGTTCCCCGATTGGCCCTTCGCCAACCCATGATAATGAACGGTCTACTCGCCCTCGC
AAGCCGCTACGATTCTCGATGCATGGACACGTCCAACGACATTGAAAGCACATTTTACCACAATAAATGCATAAAGCTTCTTATAGAAGCTTTTGCTCAA
CCCCCTGAAACATGGGACTCAACGCTCCTTACAGCCGTTGTAATCGCGCGACTGTATGAGGAGAACGATAACGAGACTGATTCCTATTACCATCATCTCA
GTGGAACGCAGAACCTTCTGAATCATGAGGCAGTCGCTAGGTTTGTGATACAGGGGGGATTAGCTGAAGCTGCAAGTTGGGTTCATCTTCGACAAGTAAT
CTACATCTACGTAGTGCGCAGGAGGCCTATCGAGATATGCCTTGAGAGCTTTGAGAGGTCAACTGTGTTTAGAAGATGTGACGATTCAGCATATGCGAAC
AGAGCGGTCTATAACTTCGCCAAGATTATGAGGCTATTTCTACAAGTTGAAAATTTGGACAGTGATCAAGACGAGTGGCAGGCAGCTGAGATGGAGGTAG
ACCGGTGGTATGACGCTAAGCCCGTATCTTTTCAACCTGTATTTCATATTTTGGCGGACCTCTCGGCAAACAGACCGTTCCCGACCCTTTACTTCATTGC
ATCAGTGCCCGGTGGATATTGCATAAGAGACCCATGTGAACAGACCCATGCCATTTGTTACCTTGAGAAGGTTAACGAAGTGATTAAGTGGAAGACAAAG
GAACTTATTGCAACGCTGAAGGAAAAATGGCATGATGGAGAGAAACATGATTCTCACTAA

Range of contig sequence

-

Contig sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+38001
38101
38201
38301
38401
38501
38601
38701
38801
38901
39001
39101
39201
39301
39401
39501
39601
39701
39801
39901
40001
40101
40201
40301
40401
40501
40601
40701
40801
40901
41001
41101
41201
41301
41401
41501
41601
41701
41801
41901
42001
42101
42201
42301
42401
42501
42601
42701
42801
42901
43001
43101
43201
43301
43401
43501
43601
43701
43801
43901
44001
44101
44201
44301
44401
44501
44601
44701
44801
44901
45001
45101
45201
45301
45401
45501
45601
45701
45801
45901
46001
46101
46201
46301
46401
46501
46601
46701
46801
46901
47001
47101
47201
47301
47401
47501
47601
47701
47801
47901
48001
48101
48201
48301
48401
48501
48601
48701
48801
48901
49001
49101
49201
49301
49401
49501
49601
49701
49801
49901
50001
50101
50201
50301
50401
50501
50601
50701
50801
50901
51001
51101
51201
51301
51401
51501
51601
51701
51801
51901
52001
52101
52201
52301
52401
52501
52601
52701
52801
52901
53001
53101
53201
53301
53401
53501
53601
53701
53801
53901
54001
54101
54201
54301
54401
54501
54601
54701
54801
54901
55001
55101
55201
55301
55401
55501
55601
55701
55801
55901
56001
56101
56201
56301
56401
56501
56601
56701
56801
56901
57001
57101
57201
57301
57401
57501
57601
57701
57801
57901
58001
58101
58201
58301
58401
58501
58601
58701
58801
58901
59001
59101
59201
59301
59401
59501
59601
59701
59801
59901
60001
60101
60201
60301
60401
60501
60601
60701
60801
60901
61001
TTCCGGGTCTTGATAGGTTTCTGGGTTGTGGAGGAACCACCATACATTGGGCAGTAGAAATGATCCCTTTGGAATGCATAGGTCTCCATAGTAGATGTCA
TCGTCGGCCTTGTGGGCTGCGCCCATTGGCACGGCCGGCATCCATCGGAGTGACTCCTTGACCATGCTATTGATATATGGCAAGTTCTCTCGATCTTCGA
ATCCTGGCAGTCTGTCAGGACCAATGACATTGTCAATCTCAGCTTGGGCTTTCTTGAGGACCTCTGGGTAAACCATCATAGCTAAGACAAAGCTCTGAAT
AGTCGACACTGTTGTGTCGGCCCCACCAGCATACATTATCGCAGCCGTGCGCTTGATATCAGCCTCGTATGTCTCGTCCAATGTGTCGTTTCCACCTTTT
AGCTTTTCTTGTGTGAGGAGGGAGGATACATATGATTCGAACTGGATCCCCTTGGCCATTTGCTGTCGGACAAATTGATAAGGAGCCTCGATAGTGTTGT
TCAGTATAGTTCTCCATCGGCGAGCTCGGGCTTTGAAAGACATGCCTGGTAGGCATTCCGGGATGTACTCGAGCCATGGAAGAAAGTCTACCACGAATTT
CATTGGGACAACCACGATACTGATACCTTCCACCATAAACTCGACCAAATGCACTAAAGGATCTGGTTTATGTGGTTCAATAGAATAACCATATGTCGCC
TTTAAAATTACACCACCGGCTTCCCTGAAAGTATGACATGTCAGCGATAAACATAAAGATCCGAAATCATGGTGACTGACTTCCTTATATGTTCCATCAA
GTTACCAGGATTATCAAGAGAGCGCAGCAGAAATCGATGTGATTCTACATCTTGGATCTGGCGAAACTTTGCAGCTCCCGCCCTCGTGCCCATCTGCCGG
TGTACCAATTTGCGATGACGCTTGAAGGTATCCCCATATTGCTGAAGACTCAAAATCTGGTCAAAACCGCACAATCTACCTCCAAAGTTGGCTGATGGGC
GTCCCGAGGATTTTCCTGATGACTTGTCGAAAAGGTAGTGCGCTGCCTCGCGGTCATGAATAAGGATGAGAGGTTGCCCCAGGACGCTGACGCTGCTCAC
GGGACCATATGTATCTTTGTGTTTAAGCCAATGCCTGAATGCAGCTACCCCCTTTGGGGGCATGTCTTTAATATTTCCAATGATAGGCAAGGGTTTGGGT
CCAGGTGGCAGGCCATGTCGTTTCTTGTTGTGAAAGGACAGAAAGTAGATAAGAGTCCCTACCAGGACGACTATAATGAGTAACATTATTTAGGTCATGG
GTTGGTAGGAACAGAAAGGAAGAGGTAGAAGTGCGAGGTGGAAGAACAAAGGTATCGAAAACACAAGGAGATATTCAACATTATGTACCCTGGTTACAGA
GTGATGATTGCAGCGCAATGGTAGGCCCAGTAGGGGGCTGGCCTTATGTTACAGCGATAATCCACATCGACTGTGGCATGACATATATGTAAGCAGTAGT
AGTTTGAAATGCGGATTGAACAAGCGATTGGAGATAGAAATATGTAGATATGCTCCTAGGTTATGCTGGGCCAAGGGGGCTGGCCTTAAGGCCTTACCTA
AGAACCCATATTATAAGGTTTATACAGTAGGAAAGAATATCTGTGCCTTTTCTGCTTTTCAATTCTGTGTTATTACTCATTAATATGTGTGAGGAATGAT
TTTTCAAGGCTCTGTGTTGTGGTGACAAGATAAAATATCCATCTTGTGAAAGATGGAAACTTCCATTTAGAACTCGTAGCTACATATCCAACGAGATAGA
TTTTGAATGGTGCAACGAGCTGATTACCACGTTTCTGAACGTTTTGTAGATAACGATGGCTTTGAATCTGATCTATCGTGTAAAGAAATATGAGTATGGC
ATTGTCCAGTCCAATGGGAGTCGTGGGAGAATTAGATATAGTTGCGCAACATATAGCTAGGGTTGACGCTATCGCTGCTATCCTGTAGTGCTCAAATATG
GGATATTGAGGGTATTAACTACAACATCGCTCGAAGCTTGTATGGTGAATGCCAGGATAGATCGCGCCTCTTGCCGCAACATGAAATCACTTCCTTACTT
TCACTAGTTTCTTGGACAGCAACTTGGCGCATAAGGGTCTGGCAATAAACGACTGGTACAGAATATGCCTCGCATTGTAAATGGAGCGGTTGTTGAATTA
AGTAAACGAAAGGTTAAACGCCCCCGAGGTAATGAAACGTTCTAGGATAAAAATACCGATTAATATGACTTGAGATCGTGGATTTTTAAAATTAGATTGC
TATATAATAACGCTTTAACTCCCTGCTTCCTTGATCATACTTCTCGTGTAAGTCCGAGGGGAAGTTTAAGATTAGATAAGTTGGGGCAGAACTGAAGCAT
GTTGAACTAGTCATACCACCAGACTAACCTAGATGAATTATTATTAGCATTACATGCTTTAATAGGAATCAAAGTCTTTAGCAAACTCCCAGTGACCCTT
ACACGTCCAATGGGAATTAATTTATTAAACATTTACATCATCAAGATCGTACCAGGATTTGAACCTTAGGCTCGCATGCCTATCTGGCTAAACAATAAGC
AAATGGGCATATGCGACTGGTTGAGTTTGTTCCTCAAGTCTAGTAAAATTACACTGCATCCCCTTTAAGTTACGGTCATTTCCAGCCCATCTTAAACAGA
CGCTATGAGGCTTTTCATCGTAAAGCTGATTACCAAGGAGCATTAGCCAGTAGAACTATTGGCAGCTATTGACTCAAGTGACCAGACCAGCTTAAAGAGG
AAAGTTAAACCCCTGACTAGCCGCAAGTCCATCGCAAACTCACCAGTTAAAACAAGCGACGTAGGCTAAGAAATAGATAGACCCGTCATCCCCTGTCCAC
AGGATAAGTCTAGAACTAAATGCACACAGGCGGTCCCGGTTTTCTTCAACGAGGACCGGCGTAAATGCGACTTAATCTAAATACTGGCAACGGTAAACAA
CTGTATTAAGTCTCAAAGTCCGCATCGATTCCAGACTTCCAAAAATTCCTCCACTTTACCCTTCGTTCAAAATCCCTTCAGTATGAAGTTGTCAAAGCAA
CTAGGGGCCATCTTGGCCCTGAACTTGTCCCTGGCCCCAAGTGTGCTGGCATCTGCAACCTGCAGTCAATTGTCCGGCAGTATCTACACCGGAAGAAACA
GCAATTCATTCGATATTTTATGCGATTCTTCTACAATCAATGGGAATATCTTCGCCTATTATTCGGATGGTGATGAGTTTCAAGACTGTGTGGATAGATG
CGATGCTGTCTCTATTTGTGTCATCGCATTGTATTTAGCGGGCAGTGGTGACTGTGCTTTGATCAACAGTTATCAAGGGACTAGGTCATTTAATGGCAAC
GATATTGCCATCAAGAGGGCAGCGACGACTGAAACCACGTCATCTGCAAAGTCTATATCATCAAACGCAGCATCTACGTCCGCTGAGACTTCATCCATAG
AGGCTACATCAACAGTGACTTCGACAACAGAACCTTCATCCACAGACGGTTCCTCAACCGAGGTTCTATCGACTGATATCAACGATTCGTCCACTGAGAC
TTCATCCATTGAGGCTACATCAACACTCGCTTCTTCAACTGAGACGTCATCAACAACAGAGACTTTGACGACAGAACCTTCATCCACAGCGAGTTTCTCA
ACTGAGGTTCTGTCGACCAAGGGTGAAGATTCATCCACTGATATTTCATCCAATGGGGCTGAATCGACAGGTGCCCTATCTACAGAACCCTCATCAATTG
AGGCTGTATCAACATCAGTGGAAGTTACATCAGAGTCTGCGTCAACTTCTGAAGCGTTTACAATAGTTACTACTACTACAAACTTGCACTACACTAGTAC
AGCTAGTATCGAAACATCGACCGATGATTGCGACGATGAAACATCAACCATTGAGACCTCGGCTGCTGAGGTGACATCCACAGCGACGGCATCCAATATA
CTGTCCACGACACTATCTAACGATAGCCTTGGTGCCCCTACTACAACTCTTCAAACAGGAGAACGTTCCACTTCGGCATTCTCTGAGACTTCTGCTTTTA
CTTCATCAGCATCGTCTTTGACAACTACGGAGAATCATAATTCTGTATCAACATCTCTGTCAAACTCTGTGACTGGCGAAACTCCCTCTACTCTTCCTCC
GTTTTCAAGCACTACCACAACCGAGACTCATGCAACCTACACCCAAGTCACTTTCTCGTCTTGGTCCTCTTTGGAAACCACAAAGCATGGCTCTAAGACG
CGTTCAGTCTCGGATATCACTACCATGACGACAGAGTCCGCAAGTCGTCTTACAACACTTTACCCTACTTCTGACTGCGTCTGGACTGTTTACCTGACAA
TGGTTGAGTATGTCACCTGCAGCACTGGTGTGGTTCCCGAGACAGCAATTACTACCAGATATGTCACTGCTACCAACCACGGGGAAAGCTATAGACCTCC
AGTAGTTGTATTGCCTTCTGGTTGTATCGGAGGTTATCAGGTAGATGCCAGCGGCCACAGCTATCCTGTAACTCTACCTACAAAGGGATCATACGGCAAC
TCTACGGACCAGGGTTATAGTCAGCCATCTGCTCGGCCCACGTCGGGATCATCAGGCAAGCCTCATTTTGGTCATGAAAACTACAACCCTCATATTCCTG
CTCAAACTCTAGAGTCAAATGGGGACTATCGGCCAGAGTACATTGATGGTCATCCGTCTGTCCCTGAGTCTACACAGGGATCACACGCCGAATATCACGA
AGATACTTCTAGCCAGCTATCCGCTGCTGGCTATGACTCACCAGAGTCCAACAAGCACGGCCCTCAAAAAACAGAAGGACTGGCTACTACAACAGCTATT
TCCGCATACAAATCTGGTGCCCCAGCAAATCTTCCAGTATCATCTGCAATCCATCATGGACAGGCAGGTATCTCATCGACATTTACAATCATGTCCACTA
CCACCAAAGACATGTATAGACCCAGCGCCAGTGAGGCACCATCTACGCCAGTAATTGCTTCCGGGGCAAGCAGACATCAGGGTATTGTTTGGACAGTGAT
TGCTGTAGCCTTTATGGCTCTGGGAGTTTAGTTTTAGTTCTACTCTACTGAATTATCTACATTTTATATATCAATTCGGGTTATGTTTGCTCTTTTAAAT
TGAATTACTTGTCGTCTATCCAATATGGGTCTAGTTGACATGGATAGCTACTTGCACCCCAAATTAGCTGAGGTAAGGATCTCAGTAGTGACTAGGATAA
TCCAGCTCGCAACTGACCCACAAGCAATGAAGGTGCGTCGATCTTCTCAAGCTGGTCTCGTGATGACGCCCAACTCCATCCGAACGAGTGTATGACAAGC
CGGCGAGGTAAGTGAAGGATTCATGCCCTCAAGCATCAATCCTTGGCGCATGGCAAAAATTTTTAAATGTCCCTATTTGCACATTGCGATCTACTCTATG
CCTAGTCTCATGGAATGAACCCATGGTTGGTTGTCAGGAGGATCATATTTTTCTAGGAATTATCGGTAATATGATGTCAATGCTAGGCGCATACTTTACA
AGTGACATTATATTGAAAATCATCATGGAGAAAAATCAGATGTACTGTATATGTCAGCTGTGGAATAGTCAGCCAGTCAATCGAAAGTTCCACTATTTGT
GTTTGCTGAAGGCATGGGATTATGGTGATCGGCAGTGAAGGAAGATCATCACTGAAGGAATGTGGGACAAATAACCTTCCAGTCTATAGGCCCGTCATCA
TTATCCTGGACAGGTAAACTTGGGCAAGGATCATAACTGGCTTATCACAAGATGCTCGAATGGCATTTCCTTTAGAGGAAGGCTACATGGAGCGTTTCTT
GTTCCGTACCGACTTACATATGAACTCTGAGACGTCAGAGGGTTGCAGCAGAGCGGATGTAATCCCCCCGAGGGCAGTCTATCAGCTTACATCTTATGAG
GCGGTGAATATGATTCATTTGACAGCGAGGCTAAGGTGCTAGGGCTGTCCCTTCCTTTAAATATAAAAGCAGTCGTAGTTCTCAAGAAAGAATAGAAACC
ATCCGACAAGTTCCTCACTCTTCAGCTTGAAAAGAATTATACTTCTACCTTAAACCTATTTCCCTATCTACACAACTTTACCAACAACTACAACTACCAA
GTCCAATCATGAGACCTTCAACTTTCTTCACTCTCGCCCTACCAACCGCCCTGGCGTTTGACCAGAAGTGCGACTTTCGACCTGTCAATGGCGGCAACAT
GCCGGGACAAAACGCAAAACGGTGGACAATTACTGGAAAGAACATTGGAGACGAAGTCGCTGGGGATGCATTCTGCAATGGCATCAAGGATAACCTGAAG
TGCCTCAATGTTGACTGGAACTGCAAGAGCGATGGAAATCGCGGTCTGAAGCTCTCATTTGTTACGAGTGACTGGTGCGGTGGGGAGAAGATCGATGAAG
CATGGTGGTTTGCTACCAAGAACGGTTTTGGCCCTCTCTGCTGCAAAGGCGGTTGCTAAACGATTTCCTGCTGACGAACCCGCTTCTGGTTCTAGCCAAC
CGCCTTTGCAATGTGGGAAGTTCGGCATGGAAGAGGGTTATCTAGATATCAGTATCATATCCTGGTGCTGCATGCTACCGAGGAGGAGGATCTTGGGAAC
ACAGGACGGAGAACACATGTGAACTTGGGATAAGTAATAACTATTGTTGGGTCTTTAGTCGGAATCTTGAAAGTTGGGATTCTGCTGAGAATAACTATTA
GCCTATTGCTAACATCATAAGTGTGCTGATATAATTATATGCTTTCTTTTCAGGCTTAGCTGGCAATATACTGACAGTTGTGAGATATGGTAAAATGTAA
ATACCGTCAAGTCGTCTGTCAGGAATCTCCAGTGCGTCATTAGCTATGAGACGATCAGCTCGTAGATGAGGGCCAATAAGGCGCTGCTGTTCCCCCCCGA
CGATAAGGTTTCCATCTTCAATTACACTTTTCAAGCATTATGACTCAAGCATTATGACTCCAATGCTTACACAAGACCTATATATTTTGTTTTTGTTTTT
GCCTTGCCCTGCCCTAATATAAGGTTCATCGCTGCTGTCCCATTTGCTGATGCACTGGGTCCCTGTTGTTGGGAGAAAGTCTGAGTTTGAAAGATTCCCT
GTAAATCGACTACCCGAGACGAATGATACAAACGTTTAAACATCTGATTTGTATTTGCTGTTGTCAGCAAGGGAACGGCTATAAAAATTGCTAATATACT
GTGTAGTAGCTGTCCTAACTCAGAGCCTTGATGGCAAAGTTGTCAAGTTTGAGTGTCAATGTTGAAACCGGATCACCTTTGACAGGGCCATTTACATTCC
AGTTCACGTCCAAGGTACAGTTTCCCGCCTGGAGGGTACCTAAGTCCACTACTGTGTTTACCCATTGGTCGACCTTCTGTTTGCTGCTCTTCCTGGGGTT
TGAGACATAACTCTCGAGCACATTGGGTCGGAAGGTAAAGTAAGCGACTTGGGCAGCACCTCCTGGACATGTAACCCAAACTGTCATCCCAGGAGCGCGA
TAATCAATTCCTTGTGCTGCATTTTTGGCAAGGTACATGGACCACGAAAGCTGGTAGCGGCCAACCTTGCAGGTCGTGAAGTTTTGCTTCATTTGGCTGA
ACGCCTGGTCATTCTGCAACTTGGCAATACCAGTAACCTGTAGCGCATGGTTGCTCTTGTAGCCTCCATCCACAATCTTCTGAGTGGTGACTTTCGGGTA
GTAGGCATGATAGATCCACGGGCCTTGAGATGTTTAGCCATGCATCTTTCGTGAGACCTCGAGTCCAGATGGATAGCATAGGATATCTTTGTTGATGGAT
GTCACTCACTTATTTTGCTGGACTCAAAACTGGGATTTTGTAGTAAGTTTGCTGGATTCGTACAGGCCTTTGGAGCCCGTGCATCAAGAGACGCGACGAG
AGAGTTGGAAGCCGATGACGGCGCGGCGAGCGCTGTAACAGCAACCGCCAGGGCATAAAGAAAGCCCAAGTTGACCATGGTGAGTATTTGATACTTGGAT
GATTTCCTAATGACGAAGTAAAGAAGAATGGAATTTAGATGTCGAGAAATATTCCAAGATGTAGCGGAGAGACCTCTTGGTTTTTAAGCATACTAGCGAC
AGATTCAGCTTTCAAGAAACAATAATATGGAATGCAAATAAACGAGCTAAAGGGATGATGTCTCGTGATTATTCAGTGGCTTGGGTCTAGATTCTAAATT
CAGTGGTCTGGACTTTGGATAGTAATGAGCTATACCATATAGTTGCGGCTAGGCAACGAAACTACTGACAACTACTAATAATTACATGCCAATATGTAAG
CGCCTCTTGCAAATTTAGAGCTGATATGGAGTACCGTTTATCCCATTGCGGATACATTCCGCTATAGTTAGTGACTACAGTCGCTTGCAGCATTAATTGC
CCATGAAAATATTGTCTTTCAAGAGCAACTGAACATTTCAGGTTGCCGAGACCAGATTCCTTATTTTCTTTTATTATCGTCACTAGAGAGTTGACAATAG
CGCACATCACTTTAGAATTGCGTACTGCTCTCGTAGTTCATAGTCAGTGTGTACCACAACTCTTGTCTTGGCTGTGTTGTTCACTTGGTAGTTAAAAGAA
GAGGATACTCAATCCTGTATCACCAATTTAATAACTGTTTTTGTTCGCGGTCCTATAGATCCCTGATTATCTCATAAATCATAGGATACCTCTACCATCC
TTACTATTTGAGTTGAGTTTCCCAGACTCATGTGGAGATCTCCCGAAAGCATTCTTACGGACAAATGTCTGCATCCACGTTCTCTGCGTGTTGGCGTGTG
CCAGTTCCCAGTAGAGTTTCGCATGTGCATCACCGTCAATGCGATACTTAGGAGATCCGTCTTCCTTTCGTTCATCGGCATAGTAGAACCTTCAGAGTCG
TTAGAGTTTCAAGCTCAATACAAGTTCAACGGCAGTAAGGGCATCTTACTTGTATCCACGATCTCTATACCCTGCCGAGGCTGCCCAAATCATATGAGCC
GCACCCGATTTACAGACGCCAGATGATAGCATTTTTGGGAGAATGGCAACATTGGTAACATTTCCAGTGTAGATGAAAGTGCGCGCAGTCGACGAAGGGA
GCTGGTCAAAGCCCAGTACGGCCTGCTGCGCAGCGACAAAAGCACTGTCGATGTTGATGTTCCTCTCAGAACGGAAATTAGCAATGGGAATGGCCAAGGG
ATCGTCAGCAGGTGTGAATGTATTCGTGCTGCAATTGTAAACGACGACGCTGGGGATGCCGAACGCCTTTTTCACTTTGTCAAACGCATTGACGACATCG
TCTGTATTGGAGAAGTCGCTCGTGATGTGAAGTTGATTGTCGGTAGGCCAACTTGTAGCCTCCAGCTGCAAAAGTACGGGCAAGAGCCCTGCCAATGTTG
GGCCCTGCACCGAGAATAAGAATGACAGGAGATGTACTAGGCATGATTTGAATTGTAAAGGACAAATTTAGCTACACAAAGCCAACCAGGAAACGAGAAG
AATATCTGCTTTATATATTCCTGTATATTCATCAAGAAAATAGACATGTGTATTAATTCTACGTCGGAGACTTCTGATATTGTTTGGAATGATTGTAATC
ACGGAACCGGATCAGTGGATCATCGTTGCTGATCTAGGCTAGACCCGGACCTTACGGAAGGTCCGAATACCAGTACAACGTCCTCGTCTTTACCAATACC
TATGAGAGTTTGTTTCATTCAGCGTTATGTAGTTTAGAATCGAGTAACTTCTTTTTTTTTTTTTTTTTTTGTCACAGATGGCTTGATAATGGAGGAAGGT
TTACTCGTTATCTGCTTATTAACCCGACGAGAGTATAATTTCTTGGGCTGATTAATTGTTTATGCTGGCGAAATGAGCTCGAGTGTTAACCATAAGCAAG
GGTCAAGAGAAGCTCTTTATCCACGTACAAGACATTAAAACAGGACGCGAATCATCACTTTTAGCCCTATTCCCATCTGTTATCTTTTGTCATGGCTATC
AAGGCGATCGTCATCGTCGCTGGAGTTGGCCCAGGTACGGGCAGTGCCATTGCACGTAAATTTGGTGCCGCCTATTCAATTGCGCTTCTGGCTCGTAAGC
GAGAAAATTATGAGGGCTTAGTAAAAGAGATAAATGAAAGAGGAGGCAAAGCCATTGGATTCAGTACAGATGTATCTAGTGAAGAGAGTATAAAGGCGGC
TTTTAGTAATATTCATAAGGAATATGGAAATGCACCAATCGCTACGGCCATTTTCAATGCTCTAGGAATCTTTTTAAAGAAGCCTCTATTGGAAATAAGT
GTGGATAAGTTTGGAGCATCCTGGCAGGTGAGCTGGTAAGACGCGCTTCGTAATGAAAGCATCTAGCTACCTAGGCTAATAATAATCGACAGCAAAGGAG
CATTCATCCTTTCGCAAGCTACTCTTCCTGGACTGCTCAGACAGGCCACAGATATTAATACACTGCATCTACCGACTCTAATTTTCACGAATACAACTGC
AGCCATTAAGGCAAATGCGCGAGTGTCTGGTAAGTTTAAGTTAATGTCTAAGACCTCGGTTGAGTATTTGTCTAACCCAATCTAGGATGCTTATCCACTC
TTTCTTCGCTGCAGCTAATAACCTACTCTACAATTTGAAACACCGTCCTATATGTCTAAGCGCGATTGCGGATCTAAAGCGCGTCGAACAATTCTTACAT
TTACTAGAGATACTCGCCAGAAACCCAACCACGGTCACACGCTCTAGGGTAGGCAAGGATAGCCGTGCTCTCTTTTGGTTCCACGTCGATCATGCCCTAT
GAGATCGAAGTCCAGCACGACTTAGGGACCTGAAAGTGCAACATTGATATCATCAGCAACCTAAGTAGCGGTGAACATGAGACGTACAGTGCGATACGTA
GTTGACTGCTTAAACAAGATTGGCTTTTGTTGCAGGGAAGCCTTGCTTCATGATGCTTTTCTGTTAATAGATAATTCTAGAACAGTGTCTTCTAAAGCTC
AGCTACCCTATGGCTATGACTTGTTGGATTATAGCCAATCACACAAGCCAAACTACCTAGTCTAGACTAGCGGAGAGGTTTTAGCGTACGTATCCTTGGC
TTCCCCGCTATTGCCTTGTTTGCCTGTGTTATCTACCTCACATTTACGCCTGCATGTTACAACATCAGAACTACAGTCGCTTGGCATCTTGCACTTATGA
AGCCAGTGAAATGCTGTACCACTTGTCGCCGCCGACACAGGAGATGCGTCACTCAGCCGGGAGCCTCTCAATGTAGCACTTGCCTTGAGTCAGGGCAGGA
ATGCCAATTCGACAATGACATTCGGTTCAAGCATAGTCATTCAAAAACTGAGAAGCAGTCAAGGAGAGAATGGGCTAAAGTTCCCTCTAAGAGTAAGTCC
AAAGCCTGCTTGGCCTCTGGCCTTCAACCTTTCTGTGTATTTTCATGCTGAAGGCTGTAGTCTCTTTCACAGCACCACGCGGAATCGACGGTATGGTGTT
GGAGGAATCAGGTAGTAACTCTACAAAGGACGAAGCTGCCAAGAACCTGTCGCAAACTGCGCAGATACCCGAAGAAATGATAGAAGTATCTGTTAATGAT
CTTGCACAATCTGGACCTCAAGTTGTGCCCTTGAACCCGGAACTCGACTACAGGAAATCAGCTTCCAACTTCATCGCCAACTCTTTAGTTGATGACCCTT
CAGTCCGTGACTCTGATGAATATTTCGACCATGCTACAGCCCAAGACCTACCGGTTCAAGTTCATATTTCATCTCCATATGAGTTGACTGAACGAGAAGC
CTTTCTTTTCATGATCTATATTTACAAATGTGCACCCTTGGTAAGTTACAGCTGTCAGATGTCGTCTCCACTAACATGACATTTAAGTCTGATGCATGTG
ACGATGCCCGTCATTTCGAACTCGAAGTTCCCCGATTGGCCCTTCGCCAACCCATGATAATGAACGGTCTACTCGCCCTCGCAAGCCGCTACGATTCTCG
ATGCATGGACACGTCCAACGACATTGAAAGCACATTTTACCACAATAAATGCATAAAGCTTCTTATAGAAGCTTTTGCTCAACCCCCTGAAACATGGGAC
TCAACGCTCCTTACAGCCGTTGTAATCGCGCGACTGTATGAGGAGAACGATAACGAGACTGATTCCTATTACCATCATCTCAGTGGAACGCAGAACCTTC
TGAATCATGAGGCAGTCGCTAGGTTTGTGATACAGGGGGGATTAGCTGAAGCTGCAAGTTGGGTTCATCTTCGACAAGTAATCTACATCTACGTAGTGCG
CAGGAGGCCTATCGAGATATGCCTTGAGAGCTTTGAGAGGTCAACTGTGTTTAGAAGATGTGACGATTCAGCATATGCGAACAGAGCGGTCTATAACTTC
GCCAAGATTATGAGGCTATTTCTACAAGTTGAAAATTTGGACAGTGATCAAGACGAGTGGCAGGCAGCTGAGATGGAGGTAGACCGGTGGTATGACGCTA
AGCCCGTATCTTTTCAACCTGTATTTCATATTTTGGCGGACCTCTCGGCAAACAGACCGTTCCCGACCCTTTACTTCATTGCATCAGTGCCCGGTAAGTG
TGACTTTCAGCTGCTGTGCTCTCTCGCTAACATATCGGAGTCGTTGCAATGCAGTATTACTTCGCAGCCAAGGCCGTTTTATATTTGCATCATTGTAAGA
ACTTGCAGCAACTGAATAACCATGGAAGGCCAGACTTTGAAGTATTTTGAAGGACTACTCTCGTCAAAGATAACACACTAATTAATTGCCAGACCAAGAT
ATCCTTCTATCTCTTCACTCTCATGGGTCTTGCTCTATCCAACTCCCATGTTCTAAACGCATTTTACCTACCTGCACATATGCTTTCATTCTGTACAGTC
ATCCCCCACCCCTAATGTGACAATGGCTGCTAACCCTTGTAGGTGGATATTGCATAAGAGACCCATGTGAACAGACCCATGCCATTTGTTACCTTGAGAA
GGTTAACGAAGTGATTAAGTGGAAGACAAAGGAACTTATTGCAACGCTGAAGGAAAAATGGCATGATGGAGAGAAACATGATTCTCACTAA
TGGGCCCTC
TCTGTTATATAAAAATAGTTCATCAATAAACTGCAAAGGTAGAATTATAAATGGCGCAGAATGGATATCCTGTAAGTGAAACTTTATGATGGAGTTTTGT
AATTAATGAGACTTGTGGCCTTGAAGAAATGTCTTTTCTTTTTACTGTCGAATTTTAGTAATACTATAGCTAGGACCATCATTTTTATTCACTAAGAAAG
ATAACTCGCTAACACATAAGAAAAGGCCAATTATTTTAATTTATCCCTATCCTGCATGTAGTCTTTAAAAGGCGTACCCTGCTTAAGGACTCAAGATCCG
GCGCCAACCCTTCAGTTGGAGCAACTCTATCCTCTTATCTATCCTCTCATCTACGCCAGATCTTAATAGGCAATTGTCCCATAATTAAGTTGAAAGCTTC
AAACCGCGACACCTTAAAGTCCTTGGTAGGCATGGCAAAATCATAACGGTGGACCAAAGTACTGACAACAATCTGCTGCTCCAGATACGAGATATTCCGT
CCAATACAGCCTCTTGCACCCGCAGAGAAAGGAATAAAGAAGGGCTCCATCCTTTTTCGCTCTGTTGGGTCAAGCCAGCGTTCGGGCTTAAAGGCATAAG
CGTCAGGGTAGATGTCCTCATTATGATGAGCGCTCCAAATCGTCATGGAGACCGACGTATTTCCTGGAATCCAGGTGTCCATGATATTGGCGCCTTCTGG
TGGCGTACGTCGTGGGAGACCAGACGACACAGGCGGGATTAGACGGAGACCTTCGTCGAGACAGGCTTTGAGATATGTGAGATCTTTCACTTTGTCCAAT
GGTGCTATGACATCATCTTCACCAATGACACCAGAAATCTCGTCCCTCAGCTTTTGGAGTTGAGCGGGATGGCTGATTAGCAGCTGGAGGAGATGTGTAA
GGGCAATAGCTGTAGTCTCAGCTCCAGCATCAATGATTGCCGAGATCTCGGCAACAACCTCTCCCCATTCAACGGCGTTGGCAACGCCGTTCTTATCGTG
CATCAGACATGAGAAGAAATCATCGAGCTTTTCACCAGCCTGGTATCGTCTCAGTCTGTTTTTGGCTTGGTGGTAGCAAACATCGACCCATGGAGCGCTA
GTGGCCCAGTAGCTCTTCCACTTGTTAGGGACGACCTTGGAGATACGACGTAGCCATGGGTACAGCTCGTACTCCCAGCAAAAGACCGATTTGACCATAG
CTGAGTGGTTCTGAGATTGTCGGTATCTAGCAGGATAGAGTGTGCCATCAGTCGTCTCGGCCATGGCTTCGTCCGTGCCGGTATCGAGCAAGGTCATCTT
GGATGAGAGAGCGATGTAGTTGATAGCTTCAATGGTCCAGAGGTTAATCCAGTTGTTGAAGTCAACTGTGAGATCTTCCGGGTCAGGGTCGGTATTTGTC
TTGAGAGGTGCAGTACAAAGAGGGTCGAATGCATCGAGAAGTCGCTGAGTGGTATACCGAACTTTGAACTCCCACTTCGCCAGGTTCCTGGTAGCAAAGG
CAGCAGAAAGAAGTCTTCGCTTCCTGCTGTGTTCACCTTTGTCAACTACATCGAAAAGATTTCGATGCGGTCCAGCAAGAACGGTTTCTTTGTGGTCTTT
GGTGCACTTTGTCTGATGACCATAGATGTCTCTGACAGCTTGTGGATGGTTGAAGGATAATGCATTGGGTCCAATTCTGAGGATGGATTCTCCACGACGT
TCGTGTTCAGCAGCCAGTGTCTCAGACCGCTTGCCCGTGTGGCTGAGATAGCAGTGTCGTAGATCAGTGAGGGGAGACAGCCAGGAGAAATTTTCAAACT
TTCTTAGGCCCTTGGGATCAGCAAAGTATAGGATAACAGGATAGATAAAAATTCGAACAAATAGGGCTGCAAAGGCAGCACCAAGAGAATAAAAGACGAT
CATGATTGCAAAGAGGTTCAATCGATGAAGATAATTTTAGTTTGAGACGAGGAGGGGGATTGCTTTTTTGTATCTTGAAGGCCTCATGAAGAGGGTCCAG
TAAGGCGGAGACAATACCGATGGAAATCCATCGATGAACCAACTGAATACTTGTCTGCATCCCTCAAGTAAGGCAAAGAATCATGTATATTGCTATTAAA
GGATATGAAACCCGCGGGGAAAAGCGCTCGGGCTCTCCGGCGAACCAAACCCAACTGACTGGGTATCACTGTTAGCCCCAGCAGGAGGAATAAATTTCCC
TTTTTGGTGATGGAGTGGGTACATGGACCGTGGGGAGAGACACGTCATATGATAGTTCAGCCTTTCGCAAGAAACAATAATAGGTATATGCGGCTGACAA
GGCAAGATAGTTTAGTCACAAAGCCAAGTGACCGTTATCTACGCAGTATGAAAGCCACTGGAAATCAAGGAAGCAACACATCATGGTCTTTCTCCAATTC
TGCTGGACTGCATGCCAGGGCATGATTGGTAACATCACAAAGTTTGGTGTGGAGGGCTAATCTAGTGTGTTGGAGAACCGGAGCAGGGGTGGAGAGTCTG
GTAGTATAACCCGCGGAATAAACTCCCTGAAATGGAGCATCCACTCCCATCCCCATACCATATCTTCCTTTGTAGTACAGTATTCTAGACCTGGGGCAAG
GATCCAGCCCCGGAATCTCCCCAGGTTTTCATTTGCGGGGGAAATGAGACCAACCTGCTTTCTAAGTTGTTGTGTCTGACTCGCAGACAATACCGAAGCT
TTGATTGGAAGCAAATCTTGGATGCAGCTGGAATACAAATAATGCTTCATGAGATCCAAAATATCCCCAGTTCATTCAATCCCAAGATCCTCACATCGTC
TTTACTCTCAACTCTTACCCATTCTTGCTCTTGATCTTCATCAACTCGAAGCTTGCCATCATGGTATCTGAAACACATTCTTTGGACGGGAAATCACCCA
AAAGTGATCTTTCGTTCGAGAACGTGGAACATCTGGCCACCGTTGAACATGCTCCCGTTGTTCTTCTTAATGAAGATATCTCTTATGGCCGCGGTGGAAT
CCGTGGCGTTATCGAATCTCCATACATTTTCGGTGTTGCTTTCTTGGCATCCATGGGAGGTTTCTCCTTTGGTTACGACCAGGGTGTCATCTCAATTGTC
AACATCATGCCGCAGTTCCATAAAGCATTCCCTCGCACTGAAACTGCATTCGGCAAAGGTCTCATGACCGGTATGTTAGAGTTGGGTGCCTTTATTGGAT
GCCTCTTCATGCCTACTCTTTGCGACAAGATCTCCAGAAAGAAGGCTCTTTCTATTGTGGTTGTGATCTTCAATATCGGTGCTATTATGCAGACAGCTGC
CAACTCTTATGGTCTTCTCGTCGCTGGAAGAACAATTGGAGGCATCGGTGTCGGAACGCTTGCAATGGTATTTAATAGGCATCCCTCGACCAGACAGGAC
AATAGCTAACCAGTGTACTAGGGAGCCCCAATCTACATATCCGAGATCGCCCCGCCTAACCTAAGAGGAACACTTCTTGTGCTGGAGTCTGTGTCCTGTG
TTATCGGCGTAGTGGTCTCTTTCTGGATCACCTACGGGACACGTGAACTCGCTGGCGAGTTATCATTCCGTCTACCATTCGGACTACAGATGGTGTGCAG
CACTATCCTTGGGATCGGCATCCACTTCTTCCCATATTCCCCACGTTGGCTCGCACTCGTTGATCGATCCGATGACGCCCTCACAAACTTAGAACGACTT
CGCCGACTACCCAGAACTGATCCTCGTGTTCATCAGGAGCATGCTGGCATCTGCAATGAAGTAACAATTCAGAAGCGTATGCAGGAGAAGCGTCACCCGG
GAGTCACAGGTCTCAAACTCGAGATTCTTTGCTGGGCGGACCTCTTCAAGAAGAGCTCCTGGCACCGCACCTCTATCGCCGTTGGAGTTGCCTTCTTCCA
GCAGCTCTCTGGTATTAATGCATTCATTTATTACGCCCCGACCCTCTTTCAATCACTGGGACAGTCGACAGAAATGTCCCTAATTATGTCCGGAGTGTTC
AATATGCTGCAGCTTGTTGCAGTTACTGTCTGTTTTTTTATCATTGACAAGGTCGGACGGCGACCATTGGCCATCTGGGGTGGCATCGGAGGAGGCACTG
CATGGGGCATCATGGCTGTCCTTGTGGGCGTGTTCAATGAGAAATGGGGCTCTAACCCAACTGCAGGTTGGGCTGCTGTGGCTATGGCATTCTGCTTTAT
TCTCATTTATGGAGTCTCTTATGCACCTCTGGGATGGGCACTTCCCGCAGAGGTGTTCCCCAACTCTTCTCGGTCCAAGGGCGTGGCTCTTGCAACAGCA
ACTGTCTGGCTCTTCAACTTTGTTGTCGGCGTTGCAACCCCACCTATGATCGAGAGTATCGGTTTTGGCGTCTATATCTTTTTTGGATCTTGGTGCTTCT
TGGCTGCTGTCTGGGCTTTCTTCTTGGTTCCTGAAACTAAGGGAAAGACATTGGAGCAGATAGATGAGGTCTTTAATGACCATGCGGCCCAGGAAGAGTT
GATGATACTGAGGAGTTAGTGGCTGTACCAGTTCACTATGGAAGTCTGTTTTTTCAATGTGTGGAACTGGGAAGATCATTTATTTTTGTTGCTTTCTTTG
CCCAAGTAAATAGTGGGCATTTCCTGTCTCTATATTTGCATATCTGTAATATAGAATTCACTCTCGTCGGGAGCTGAACAATTATCTCAGCCAAATGCAC
GAACTATTAATAAACTAATGGAAAGAAATACAATGCAACACTCGAGTCTGGACTTTCCAAATGCTCCAAGCCAGTCCTGAGTATGTAACAGCGACGACAC
CGCACCCAGTACACAAGAAGCATCCGGGCTTCTTAGTCCAGATGATATCTCAATCAGAATCCATACCGAGAGAGACACACAGAGCTAAGATGGATAATAC
CTCCGGATCCTTTACAGATGCATGCTACTACCGCCAGAGCTACTATTACGCTTAATGGGCTAAACTACTGTCCAGTATCCTACAGTAAAATCGTTGCTAG
GCAGACTGGCCTTCTCTGCATAGATTTCTAACTTCTGGCTTATTGTTTTGTGTTATCTTTGACCAACCATCTTCAACTATAAGTGAAACGAATAAAGTAG
CAAGTGCGAGAAGAATATCCCTTTCTTAGGTCGCAGGCCACAAAGCTCGCTTCTGCCGATACAATACGACGCAGCGCTGGGCTGACTCCTTGGCGTCATT
TCGGCTCCGTTTCAAAGAACCCACCTTTCCTTACGTCTTAGTGGTTCCCATTGGACAAAGAACTATACGAGAAAATAACAGCCGGGTGCTATAGGGACTA
ACCCTTTCAGGGACGACTCCCGTCCTTGGCATAACGTTTCTAGTCAGGCTCAGTTCTTTTATATACTGCTGCTCCTTTGCTCGATGCATGCCTGATTGAC
TATCACCTTGCTTCGCTATTGCCCTAATTTATGATAGTATCATCCATCAATATGCTTGCGCTGAGCACTGTTTTTTTAGCTTTGGCTGCTACAGCTTTCG
GCCAGGATCTCAACGGTAACGACACAACCAACGGCACTCTCCCGATTCGCGGAGATTACATATGGAAGCCAACATGCAAGCTACCCTCGCCTAAGGATTT
CATGTTCAATATGGGTTTCGATTTCCGCGACGGCTGTGTCAAGGGCACTGGAAATCTGGAGGCTTTTGTTATGTTTGTGGATTTCCCAGATGCTAAAGAC
GAAGATCCCGACTCGCTCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNGAAGCTGAACATAAAAGCCGATACCTCTCAGTACTACCGCATGCCCAAGGCGGCGTCTGAGTATGACTGGCTAGGCAGAG
GAGCTGGCTTTTGGCGACATGATCGTTATATTCAGGACGCCCTTGATGCTTTCACGGCCGAAGGCACTCGCCCGCCCCCCGCCAAAGTGGACGTCCTTTA
TGTGATTCCAACAAGCCAAGCAGCAAATTACATCTCTCGCTCTATAACCTATTACGACCCTGTCTCAACGCGTCAGGGTAAGCGGGTAGCTAAGAAGACT
GTGACACTTGGTGCCGCCGACTGGGATCTGATTGCGATGACCATGGTTCATGAAACGGGTCATACCTTCTGCCTACCAGATTACTATTCATTCGAAAGCT
ACGCAGGCTTTTATACGGGAGGCTTTGGTGTCATGTCCCAGACTGAAGGCATGGCGCCTGACTATTTTGCCTGGGATAAGTATCGCTTGGGATGGATCGA
GGACAAGGCTGTAGACTGTGTTCTTGAGGCCGGCAGCACGAAGCATGTCCTTAATCCCCTTGCTGTTGATGGTGGAAAGAAGGCCGTCGTGATTGCAGGC
AGCGAGATTTCTGCTCTTGTAGCTGAAGTTCGCACTGCCAATGGTCTGGATAAGAACCTTTGCGCTCCTGGAGTCTTACTTACTGAGGTTGGTACGAGAA
CTGCACCCGGCAGTGGCCCTATTCGAGTTCTGGATGCTACACCTGGCTCTTTAGGCTGCGTTGGGAACCTCGATGACAAGAATGATGCTGCGCTGTCTCT
GACTCTGGAAGGAAGCAATTCTCTTGCCTATAAGCCAGTTAGCTCGTTTGATGTGCCTGACTGGGATGTTACAGTAACACTGTTAAGTGTGGAGGACTCG
AAGTATACTATTCGCGTTGACCGCCAAACGTCTGTTAAGACTGATTCCTGGTAGTGTTATACCTTACTCAATTGACCGCAGACAGTTTCTAGATGAAAGA
GATGAGCTTGAAGCCCTGCAATAAGCATTAATATAACATTTCCCAGACTCAGTTATCAAGGCGCACAAATTGTATCAACACATCAGTAGTCACGCTACTC
CATCGTCCACAGTCACAGTCGCATTCGCCTCGGTTATGAAATTTAGAATTATCAGTTGATTAGCTTGAGGCGACTCAAGCTGCCCGACTCTAAGAATACA
AGGAGTCCGTCTTATTACTTTCGACCTTGAAGAGTCGTGTCGCATCATTTTTCCCGTATTCGTTGTCTTTTGTATTATTCTTAACAATCATGGCAATTTC
ACACGGAGCGCGACTTAAATATTTACATAGCGGTGGTCTTGAAGGAAGATTGTTGGTCCACTTGATCTTGTGTTTGAGGGTTTAAAAAAAACAGAACTGG
CATTTGAGGGTTGTGAGAAAGGCACGGCAATTCGAAAGGTTGAGGTCAAGACAACGATTGTTTGACTCTGCAGTACAATAACCAATCAAACGTAAGAGAA
TGTATCCACTGAAAATGTATTTTGAAACCTTCAAGTTCATCTGTCCAATGCACGCCGGATTTGTTTGTCTATCCTAGCATATAGGGATGGTTTGTACTAC
AATATCTAAATTAATCGACCATCATTACAGAGTGGGAAAAGGTTATTCAACTACCAATATGTGTTTTTGCCATAGAGGTGACAAAACGATTTGCTCTTGT
TACTCCAGGCCGAGATGCACTAAAAATGTCAATGCGACGTAGAGCTCCTAGTAACTGCGAATGTTCCCTCGAGGCTTTGAGGTCATATACTCACAAATTA
ACCTGGAGCAAATCGTTGGTACGATTCCTGTTCCTGTAGATCAAGAAATGGCCTGAAATAGAAAATACTTTTCTTTGTAGGGTAGGAGGAGTACTTGCAC
GCCACTAATTTCCCACCTGGGCGTTGAGCCTTTACAACTAATGATTTTGGCGTTACCCCTGATGATCCCTGTCAAATTAACGGATTCAGCTCAGCCGACG
TCAAGGCTATCAGTAAACCTTTCCAAATACAGTCAACTAACATTGATCTGCACTCAATCATAACGACCAAGCCGAATCAAGACTGACCGTTGGGACAAAT
TCAGAAGGAAAACAAACATTAAATCCATATCGACCCTCATCTTTCTTTTCCGCACATTGTCGCGAATTTTGTACAACTGAAAAATAACACAATTGCTGTA
GAGATGGTTAGCCCTCTCGTTCATTCGTTTGTTATTGCTGCAGTATGGAAAGACATGCTCCAGGGGATGGACTCAGTTTCACAGGTTAAAGTTAGTACCC
TTCTTTACTGTAGCACATGTTGGGCAGGCTGCTAATTATTTTTAAGGGAGCATATATTTCGTAAACACTGTATTCCAGGATATAAATGTTCTCGCTGTGT
ATCATGTTTCGACAACAGTGATGGGCTTGAGGGACACATACTCTCTGTGGAATCTTGCAAATTGCGGGAATCTACAGAAGCTGAGGGCATAAATGCTGAA
CAGGAACGTCGTCTCCGTACAAGGAAACGGACCAAAACTGAGGCCGACTCGAATGAAGCTGTTCGTGATACACAACGATGGTACGAGATGTACAAGATAA
TATTCCCAGACGCTGATGTACAGACAATATCTCCATGTGAGTAGCATCATCAAACAGCACGTTATAACACTGGCACTAATAAGGCAATATGAAGACAATG
ACTACAACAACGGAGCTTCCACAGCCGTTGGCTCATCAGAAACAATCGCCGATTACAGCAAGTTTATAGATGGAGGTATTCCCTCGAAAGTTCATAACAA
ATTGCAGGCAACTATCAATCGGGAGCTTGGATATAGTGAACTGGACGTCAGGAGAATTATTGACATACTTCCCATGCTGCAACAGACACTCTTACAATCC
TTCCAGAACCAGAATGATAATTAAACAATTCATAGTATTCGATTAAACGAGAGGAAGGCGGGGTCGGGGATGTATCTCTTATTGCGCAGAATTCAGATAG
ACATATAATTTAACTAGGTGAAAACCTTCAAACCCAATATCGCACTCTTCCTATCCTCCACGATAACATCTGTAACTGCCTTAGTGTGGATCCTCCGTGG
CCGAATGCATCTTTGAATTGGCCTTCAATCAATTGTTTGGCATTCTATATCCATTGTACCTCACTTATCATTGCGGGTCAACCAACCCTCTCGGCTGACA
GTGAGTAGACCATAGTAGTCAAGAATTAGATAGGAATAGTCCATAGCGATGGCGGCCCAGAGGTTCTTTATTCCAACCCAAGGGAACAGGGTAAGAAAAG
ATCGGTAGGTACTAGCCATTTGATACAAGTACCAGACCATGAAGCAAAGACTATGTTCTAAGTCAGTCTGGATCTAAACTTGTAACAACAGGTTGCATCT
GGGAAAATAGAAACGTCAACTTACGCTATTCTCGGTGAGTTCATTATGCATAGTCCCCAACCAATGAGATGGACAAGAGTGATGAGAGGGCGTCCAAACT
CCTCGGCAAGCTTACGAGCAAAGTAAGCATCCCTTTGATAGATGCTTCGAAATCCAGGATCAATAAAGAGCTGATTGATGAAAGCCTGGAACCCATTGCG
TCGCCAACGAATAAGTTGGCCAACGTACGTGGAGTCGCATTTGACCTCGGTGAAGACTTCAGCCTCGCGTGCGTCTTGGTGGAATAACTCCCACCCATTC
CGACGTAACCAACGGGTTATGAAGCTGTCCTCACCCGTTTGGAGGAGTCCACCAGCGAAGATCTCATTTGTCAAATCGTCCAGGAACGTACCATGCTTTA
GAGCAGCAGTTCGAAGCAACATGGTCCGACCTACCAAGCACCATATGCCGCCTCCATTGGCGTGGAGAAGCATCTGCTTCTCGTTGTTGCTTGATAGCTT
TCGGATAGCTGCGACTTCCCAAGGTGTAAGAGCATCAGGGTTTTGTCGCTCTGTCGGAATCCAAGCACTTGCAGAGGTTAGCTCTTAGTCAAACAAGGGT
CCTATACTCGTACTTGCCTTTGTCTACCAACCACGCCTCCGACCCTTGGGTTCTCGAACCCCGCGAGGAGATACGGCAACACATTATTGGTGGGCCATAC

Favorite :