Fusarium Genome Browser

Detalied information of a protein

Locus name

FOXG_00014T0

Gene name

Protein name

predicted protein

Species name / Reference name

Fusarium oxysporum f. sp. lycopersici [Fusarium oxysporum 2A PROTEINS]

Position of protein

supercont2.1: 42602 - 43210

Position of transcript

supercont2.1: 42599 - 43210

Amino acid sequence length

115 aa

Amino acid sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
MSKFRPQPENAGNNQPSTLYSLVMTPVNITVFLFSLLLVDFRHTAGRNNFYGTEEAHEDGSRRSVQMRSTMLVFMAVALALATSAVWFLTSRLYYGVASL
VEPHTANQTIPPTGP

Gene sequence length

345 bp

Gene sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
ATGTCCAAATTTCGTCCCCAGCCTGAGAATGCTGGTAATAACCAGCCGTCTACTCTCTATTCTCTCGTCATGACGCCTGTCAACATAACCGTCTTCCTCT
TCTCACTCCTCCTGGTTGACTTTCGCCATACTGCTGGCCGCAACAACTTCTACGGTACCGAAGAAGCTCATGAAGATGGAAGCAGACGAAGCGTTCAGAT
GCGGTCTACCATGCTCGTGTTCATGGCCGTGGCATTGGCTCTGGCTACGAGTGCTGTCTGGTTCTTGACGAGTCGTCTATATTACGGTGTCGCTTCTCTT
GTCGAGCCTCATACCGCGAATCAAACGATCCCGCCTACGGGTCCG

Genic sequence length

609 bp

Genic sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
401
501
601
ATGTCCAAATTTCGTCCCCAGCCTGAGAATGCTGGTAATAACCAGCCGTCTACTCTCTATTCTGTAGGTCACTCCTCGTTCAGACATTATCTGTGGTTGT
TGCCAAGAGAAGACAGAAAGCGTCTTGTCTTGTCTTCTTCTTTGCTTCAAAGTCTCATGATATCAACGAACAAGGTCGTATTCTCTGCTGGTCACAATAA
CACTGACACAGGTCTTTTAGCTCGTCATGACGCCTGTCAACATAACCGTCTTCCTCTTCTCACTCCTCCTGGTTGACTTTCGCCATACTGCTGGCCGCAA
CAACTTCTACGGTACCGGTAACCGGCAAGCGAAATGGGTGCCCCGATGGTTCCTCCAGCCATACCAGCACATTGGCCATAGCGATCATGATGCCCATGGC
CGCTGGCACTATCACAGCAAACAGAAGAAGCTCATGAAGATGGAAGCAGACGAAGCGTTCAGATGCGGTCTACCATGCTCGTGTTCATGGCCGTGGCATT
GGCTCTGGCTACGAGTGCTGTCTGGTTCTTGACGAGTCGTCTATATTACGGTGTCGCTTCTCTTGTCGAGCCTCATACCGCGAATCAAACGATCCCGCCT
ACGGGTCCG

Transcript sequence length

609 bp

Transcript sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+ 1
101
201
301
ATGTCCAAATTTCGTCCCCAGCCTGAGAATGCTGGTAATAACCAGCCGTCTACTCTCTATTCTCTCGTCATGACGCCTGTCAACATAACCGTCTTCCTCT
TCTCACTCCTCCTGGTTGACTTTCGCCATACTGCTGGCCGCAACAACTTCTACGGTACCGAAGAAGCTCATGAAGATGGAAGCAGACGAAGCGTTCAGAT
GCGGTCTACCATGCTCGTGTTCATGGCCGTGGCATTGGCTCTGGCTACGAGTGCTGTCTGGTTCTTGACGAGTCGTCTATATTACGGTGTCGCTTCTCTT
GTCGAGCCTCATACCGCGAATCAAACGATCCCGCCTACGGGTCCGTGA

Range of contig sequence

-

Contig sequence viewer

|......10|.......20|.......30|.......40|.......50|.......60|.......70|.......80|.......90|......100|
+32601
32701
32801
32901
33001
33101
33201
33301
33401
33501
33601
33701
33801
33901
34001
34101
34201
34301
34401
34501
34601
34701
34801
34901
35001
35101
35201
35301
35401
35501
35601
35701
35801
35901
36001
36101
36201
36301
36401
36501
36601
36701
36801
36901
37001
37101
37201
37301
37401
37501
37601
37701
37801
37901
38001
38101
38201
38301
38401
38501
38601
38701
38801
38901
39001
39101
39201
39301
39401
39501
39601
39701
39801
39901
40001
40101
40201
40301
40401
40501
40601
40701
40801
40901
41001
41101
41201
41301
41401
41501
41601
41701
41801
41901
42001
42101
42201
42301
42401
42501
42601
42701
42801
42901
43001
43101
43201
43301
43401
43501
43601
43701
43801
43901
44001
44101
44201
44301
44401
44501
44601
44701
44801
44901
45001
45101
45201
45301
45401
45501
45601
45701
45801
45901
46001
46101
46201
46301
46401
46501
46601
46701
46801
46901
47001
47101
47201
47301
47401
47501
47601
47701
47801
47901
48001
48101
48201
48301
48401
48501
48601
48701
48801
48901
49001
49101
49201
49301
49401
49501
49601
49701
49801
49901
50001
50101
50201
50301
50401
50501
50601
50701
50801
50901
51001
51101
51201
51301
51401
51501
51601
51701
51801
51901
52001
52101
52201
52301
52401
52501
52601
52701
52801
52901
53001
53101
GCGCCGACTTCCATACGATGCTCTGGATTTCTTCGGTTTGGTGGGTTTCGTAATCATCGGAGGTTCTGTAAGCCGATACACTCGGTTATCGTCCAGCACG
AAGTAGGTTCTGTCATCTGCATCCCAACCATATGGTTCTATTCGCTGGAGTTCTGTTAGTGGCTAACCCCCTTTTTGTTGAGATGTGAACTTACCCAACT
TGTTTGCTCGCTATCTTTTTGCTCTTCCATCTTATCCCGAATGCGCTCAGGATGGATCATGGCCCATTGAGTCAGTTGCTGCATGACCTTGATCTACCCA
GACAGTGTATATTAGCCTTGGATCACTAACCAGGCCTCGTAATTTCTTCATAGCCTACCTTGGTAAAAATGTCGAAATCGTTGAATTTGAGGGGTGTTTC
ACCAGAACCGAAGGGGTTGTAGTTCGGCGATCTCTTCGTAAATTGTTTTCGTGCTTGGTCATCGAAAATTTCATGCCTTCGAATCACCATTAGCAAAAAA
ACAGCATCTCCTAATTCCTGGAAACGTACGTTAAACCACGATGCGACGAAACTAGTTTGAGGAGGGCGAGGGCAATGTCTGCCAAGATGCTTGAGTTCGG
CTTGAGGCATTCCGTTTCAATTTCCTATGAAATGTGTTAGTTTGTGCGCCTATCGCATTATTGAAGAACTGGGCTGCTGTGTGGCCATACCTCAACATCA
ATAGCTTCGTCGATTTTCGCAGCCTTGCCAAATATGTATATCCACTGGCAAAGGTTCGCAAACTGCCACATATTACGGATGCGATGCTGTAATGAGTGTT
CTGTCTCACCATCGTCGCCATCGATGGCCGCAAGCGAGCGCTTGCGAGACGGCATGGTTGAAGAAAAGTTGATGATGTCGATGTCAGGATGCTAGCCAGT
CGCGTCACAATTGTCAGAAGCGTGTTTAGGCGTTTCTAGGTCGCGAAAAGCTGGGACGAGCTGTGGCGCACTCAGCCACAAGCACATGCCACTTGTATCA
CTTTTCGACTACCCTGGCTGGCCAACCTGGGAATTCAGCTTACGACCTCCATTTTCCAGGGGATGAAACTCTCCACACTGTAGCAGAAACCTTGTTCTAT
AAAAAGCACACGGCATTTCATTGCACTCTGCCAAAGAAGCTGCTGTGTGTACAGTGCGTAAGCGGGAGCTTACTGTCACATCCAGCCGTCCTACGGCATC
CTAGGGACTCCTGATTAGGATGTAGCGAACTGGCTACCTCTTTGCTTCTACGAATACCTCTAAACCATACCTAGTTCACGCTCTCTATCTTTTTTTTTCT
TTTTTTTTTTCATGAAGCGCTAACGATGCTTCATTCTGGTAGTAGTACTAATAATCACTATTCTTCATGACATTGGACCGCATTGGCGGTCATTAGTCCT
TTCGTTGGTCCATGTCTTCACACTCTTGGGATCAAGACGGGCGCCCTGCGCGGCGCCTGTCTATTCCGCTTCAGAACTTAGACGGATCGCATCTCGATAA
TCAACAGACGCAAGCTGGTCTGTCACGGCAACAACCAAGCTCTGTTTCTCCGCCCGACGTTCCTCAAATGTCTGCCAATCTTCCTGGTATCTCAACATAT
TGGGACCAACCCTACGATCGTTTCGACGACGATGTTAGCCCAGGGTCACCTATAGATCCAATGGCTCTACAGGCTGCGCTCCCTCCGGGTATGGATCACC
ATCAGCCAAGTCCTCCAATGCCTTCTACACCGGTTCGTACATACGACCCGCCTGCTCCCTATGTCGAAGATGCGCCGAGTACCGATTACGCCGAGTCCGA
TCGAGTTCCGTTGACAGCTGGAGTTGAGCCCATCTCTGGTTCTTTATCTGCCAGTAATTTGGATGACCGAAATCGAGACAGTTTTCAAACAGTTTCAAGT
CTGGAAAACAGCCCGTCGCGCGGTCGCAATACGAGAAGCCTCGGCGAAGATTTAAGAGCAAGCTATGGTTCAACTCGAAATCGTAACTTTGGCGCTTCTC
TTAATCCTAACGAATATCGAAGGTCAAGGTCGCCTTCTACATCGGGCGCTTTGTCCCGTGCTGGTTCGATTGTGCGGGCAATGTCACAGAGAGTTGTCAA
CATAAGCGGAGAGACAGAAGTCATTGATCATCGTGCATCGAGGCATCGCTCCCGCTCACCTAGTAGACATGATCAAGATAGGAATCGGGATACGATGAAT
TCGATGTTTGCCGATACTTCGTATCAACCACAGTTGGTTCGGTCGTCAAGCGAAAAGTCTACAGAACCACGTTTTAATGTGACCGAAGCTGAGCCAGATA
TACCGAGGCCTCCTTTACCAAATCCTCTCAAAGGAAAGTCTCTGGGAATCTTCTCACCGGACAACCCTTTGAGACTACGACTCTGCGACCTCTTGGTCAA
CCCATATACGGAGCCATTCTTGCTTCTTTTGATAGTCTTGCAGGCTATTCTTCTCGCAGTTGAGGCTGCTCCGAATGTATTTGAGAATGGACGCCCAGAA
AGATGGGGACAGCATCCTATTGATTGGGCTATGCTTGCTCTTTTCATTATCTTCACTCTGGAGATTATCTCGCGTATTATTGTGTCTGGCTTCGTGTTGA
ACGCAGCAGAGTACAGTACGATTGACCGTAAACGGGGAATCCGAGCCGCAATAGCAGACCAGTATCGTGCTGTTTTCCAACCGGAGCGGATAAAATCCGT
AAAGAAGACGTCGCAATATCGACCGGAACCGTCAGCAATCTCAAGATCTTTTACAACTTTTATGCAAGGCCAGCAAGCATTGCCAAGAACTCTGGAAGAG
CACCAAAGGTTTCAGCTTGCTCGGCGAGCATTTCTACGCCATTCCTTCAACCGTTTCGATTTTGTTGCCGTTGTCTCGTATTGGATCACTTTCTGCTTGA
GCATTTCTGGCCTCGAAACTAAACACGATCTTTATGCATTTCGAATGCTGAGTTGTTTACGAATTTTGAGATTACTTGCTCTAACGAACGGTACTGCGGT
AAGGTTATCATGATGCTTGAACATATCAACAAGCACGCTTACGAATTCTTAGATTATTCTCAGGAGTTTAAAGAAAGCAACGCCTTTACTCGTTCGAGTT
GCATTTCTCCTCACATTCTTCTGGCTTCTGTTTGCAATTATAGGGGTCCAGAGTTTCAAAGCCAGTTTGAGTCGGCAGTGCGTGTGGCTTGACCCCCTTG
ATCCTACGGACCTTGATGCTTCCTACACAAACGAGGAAGCTTTTTGTGGCGGTTACTTGAACAACCAAACGGGCGAAACTATGCCGTGGCTCAAGTTCAA
CAATTCAGAGTCCTTGACGGACCTTATGAATGGAACCAACGAAGGAAAGGGGTTTCTGTGTCCTCGAGGTTCCATTTGCCTTCAGCAATCCAACCCGCAC
AATGGCACGGTCAATTTTGACAACATTTTCAACTCCCTGGAACTTGTGTTTGTCATCATGAGCGCAAACACCTTCTCCGATCTTATGTACATGACCATGA
GCTCGGATTATGTCCAGGCCGCTCTCTTTTTTGGTGCAGGCATCATGATCATGATGCTGTGGTTGACAAACTTGTTGATTGCTGTCATTACCTCATCCTT
CCAGGTCATTCGTGAAGAGAGTAAAGCCAGTGCATTCACTGTCAGCCAGGAATCGCCGGTGCAAGCTCGATCTGACGAGAGAATTCGCCGAACATCTTCT
TTACAACGCATGTTCCATAAAACCCGTGCAGTGTGGATTCTGATCATCACTTTTGGGTTGCTATGCCAGGCCTGCCGCAGCGCAACCATGTCAGCAAGAA
GAGAGCGCTTCATCAACACTGCAGAGATCATCGTTACCATTCTTCTCGATATTGAGATGATCTTTCGAATTGCGACTGATTGGAATCACTTCCACAAAAG
TTGGCGTAACCTCTTCGACCTCGGCCTTGCGATTATCACCTCCATCATATTAATCCCCCCTATTCGCTATACCAGAGCGTATTGGTGGTTGACGGTGTTC
CAAATCCTGAGAGTTTATCGTATTGTGTTAGCAATACCAGTGACAAGGGAGCTTATTCTCCTCGTTTTGGGCAATGCTGCTGGTATCGGAAACCTGATGT
TCTTTGTGTTTCTGATGACATTTTTGGTGGCGATTTTTGCTGCGCAGTTATTCAGAGGCGAAATTCCCGTGTATGAAGATGGCGAGCTCAATCGTATCTC
GTTCTACACTATTTACAACTCCTTCTTGGGCATGTACCAAGTTCTGACAAGTGAGAATTGGACAGATATTCTTTATACTGTCACCTCCTACACTAGGCAC
AAGAATACCTCATGGATAGGAGCTATTCTACTCATTGGCTGGTTCATTGTGGCTTTCTTCATTCTCATCAACATGTTCATTGCTGTAATTCAGGAGAACT
TTGATGTATCCGAAGACGAGAAACGGCTTCAACAAGTCAAGGCTTTTCTTCAAAGGCGAGACCTTGGAGCTTCATCAAGCAACCTGGCCCTTTCTACAAT
ATTCGGCCTGTCCAAACATCGCAAAAATAAGGACCCCCTTGACTACGGGCCAGCAACAGTCGAGATGCTTCTCAAAGATGCGGTGGTCCGCGAGTTTCTG
GATGATCAAATGAATCCTAAACCTGAGGAGGACCGGTTGCACCATGCCCCTATTAGAAGCGCAACTACGCTGTTGGGTGGTGAGATCAAGCCTGGCCGTC
TCTCTGCCATGTGGGGACGGGTGAAAGGGTGGTTCAGCGACAAAGAGCCCAACCCCTTTTATTCAAGCTTGCGGTTTGACGGCGCGAACGATACCTCAGA
TCCTCGACAAATGGCTGAACAGGCCATGTCTGCCACTATGACTCGAAAGAGGGCTCAGCGAGAGTATCTTGCAAAGTACCCAAATTACAATACCTCCTTG
TACATTTTCCCACCCAACAACAGCCTGCGCCGACTTTGTCAGCGGGTCGTTGGTCCTTCTCGGGGCATTGAGCGCATTGATGGTGTAGTTCCCGATACCC
TCCTTTGGTATTCTTTCACGATATTCATTTACGCAGCAATCGTGGCTATGGTCGTCCTCGCATGTGTGACCACTCCTCTTTATCAGAAGGAGTATCAAGA
ACAACATCAGTTCAGTATTAGGAATTGGTACATCTGGACAGACATGGCTTTTGCGATTGTGTTTACTGTTGAAGCTGCGATCAAGATCATTGCGGACGGA
CTCTTGTGGACCCCCAATGCATACTTGCGAAGTTCCTGGGGATTCATGGACTCAGTTGTTTTGGTCACTCTGTGGATCAATGTCGTTACGCTCCTTATCA
ATGACGGCGCTATTTCCAGAGCAATAGGCGCATTCAAGGCGCTTCGTGCACTTCGACTGCTGAATGTTAGCAACAGCGCTAGAAACACATTTCACGATCT
CATTATCGTTGGTTGGTGGAAAATTCTAGGCGTGAGTTGCCATCTCCTTACCTGTAGCCGTGTTCTTTGCTAATTGCTTTCCTAGGCCGCGTTTGTCTCG
ATGTCTCTGCTCATCCCGTTTGCCATTTATGGTCTCAACCTATTCAATGGCTTACTTTTGTCTTGTAACGATGGTGGCGACGGAATTAATACCATGGATA
ATTGCTATGGCGAGTTCGAGAGCACACCATTTAGCGACGACTGGCCAATGCTTGCTCCGCGTGTTGCAGCGAACCCCTTCTTCAGCTTCGACGATTTTGG
GGCATCTTTATTTATTCTATTCCAGATTGTTAGTCAAGAGGGATGGACAGACGTCTCTTTTACTGTTCAAGCCATTACCGGCCGCATGAAGCAGCCCCAA
GACCTAGCGTCGGAGGGCAATGCCATCTTCCTTGTCGTATTCAATCTGTTGGCCACCGTCTTCGTACTCACGCTCTTTATCTCTGTTTTCATGCGTAATT
ATACCGAACAGACAGGTGTCGCTTATTTGACTGCGGAACAACGGTCATGGCTCGAATTACGAAAGATCCTCAGACAAATTTCACCTTCGAAGAGTTCGTA
TGACGATTCTGAGAAGAGCTGGAAGAAATGGTGCCACAAGAGAGCCATCGAGAAGAAGGGTAAGTGGTACCAGACAATTACCGTTGTTCTAGTACTGCAC
TTGATCGTGCTTGTCTCGGAATTCGCCAGTGAGCCATGGTGGTGGACGCGATATCGCGACTTCGTTTTCTTCGCCTTCATCGTGGCATACACGGCTAACA
TTGCAATTCGTATCATTGGTTTGGGCTGGGTGCGTTTCCGACGAAGCTCGTGGGATCTTTACTCTCTGTTCATTGTCTTCGGGGCATTTGTTTCAACTCT
CGCGTTACTCATATCAGACACTGAGATTGAAACCTATGTCCAGCTACATAAGGTGTTCTTGGTCGCCATTGTACTCCTCCTCATTCCTCGCAACGATGCA
CTGGACCAGCTGTTCAAGACGGCCGCTGCTAGTCTGACAGTTATTGGTAACTTGCTTGCCACCTGGCTGGTATTCTTCCTGGTCTTCGCCATTGCCATGA
CTCAAGCTTTTAGTTTGACACGATTTGGCGAAGAGACTGCGGAAAACATAAATTTCCGAACCGTCCCCAAAGCCCTGATTCTGCTATTCAGGATGAGTCT
AGGTGAAGGATGGAATGCTGTCATGGAAGATTATGCCAGCATAGAGCCGCCACTTTGCGTTGACGAACCTAGATTCTTCGACAGTGACTGTGGTAGCCAA
TCGTGGGCCAGAATCCTGTTCATCGCATGGAACATCGTCAGTATGTATATCTTTGTGAACCTGTTTGTGTCACTCATCTACGAGAGCTTCAGTTACGTCT
TTCAACGCTCGAGTGGCATGGCTGTTGTTGATCGCGATGAGATTCGACGGTTCAAAGAAGCTTGGCGAAGCGTTGACCCAGCAGGTACTGGGTATATCAC
GAAAGCAGCCTTTCCCCGTCTTCTTGGCGAGCTCTCAGGCGTCTTTCAGATGCGCATTTATGATCCAGAGGACAGCGTTCATTCTATTTTGGAAGATATA
AGGGACGATGTGAAACTCACACATCACTCGTCCATCGCGACAACCAGCGGATTCAGTGGCATTGACCTGAACAAACTCAATGCACGGCTGAGGAGGATTG
ACGTGGAGAAGGTGCGCCACCAGCGTCGGCGCTTTAACATTTTTTACGAGGAGGTCTTGGTGTCCGCAGATCCCGACAGGGGCATCTCTTTCACGAGTGT
CTTGATGATTCTTGCTCACTATAACATCATCAGTGATAACAAGAGCCTAAAGTAAGTTATCCGACCTGCCGCATATCTGTACACCAAGGCTGACAAAAAA
CCGCAAAGACTCGAAGAGTTCCTAAGGCGTCGAGCTCGTCTCCAGCGAGTAGACGACCAAGTCCGACGTGGCGTGGTATTGGGCTTCTTCGACACATTGT
AAGCTATTTATAGCCGAACCCAGGAAAGGAAAATTGCTCACCATCAACACAGATATTATTCAAGACAATTCAAGAAACATATGCTACGAAAGCACTCGGC
CCGCATGACGGCAGTTCCACAGCTGAACATTCCGGAGATTCTTGTTGAGAACGATCTGAGCGACGATGAAACAGGTGGAGCAGGACCGAGATCTCCCCTC
TCACCAGCCTCGCGTCCATCGAGTGTTGACGCAGGCGAGCCACGCAACTGGCTGGGATCTGTGGATCTATCGTTGCACGACACATCGTGGAGTCACCCTC
TCAGCTTCCCCAGGGCCGCGCCTCCATCACCCACAACACCTGCGCAACCATCAGCCTTTAGCTTTGAGATCGAGGAGGATGATCCACATGAGCAACAACA
ACAATCGACGACGCAAGCAAGATCGTCAGCGCCTCGGGCCGTGAGAGCAATCATTTGGACCCCATTAGCCCTGTGCAAGTCCGTGGAATGCTTGACGACT
CGGTTTGGGGCGAGAGTATTCGCCGCAACGCCACAGTCCGACAAACACAGAACAGGGGCTCACAAGGGTATGATGGTTTCCACTGAGGAGGAAGCGATGG
AGGAGTTGAAGTTGCGGTTGACATGGAACTTACTTGTGAGGAGGAGGGAAGTCCAGTTTTGGTGGTGAAACAATGCAATCATGCACATGGCATCAATGGA
GGTTGCATTCAGGAAAGCGAACTCATGGCATAATTCAAAGCTGAGCACGGCGTTCCAGGGCAATCAATACATGAGCAACGAGGGGGGGGCAAGGCTACCC
CCGGTATCTAGTTTCGGTCGATCAAGATTCAAAATAGACATACATTTTTCATGCACAGAACGTTCGGGTACCAAGACGGCCTCTGTGTAGCCCAGTGCGG
TGATACGCAAGAGCAAGGTGTGAGACTGGAGACCTGACGCTTGTCTGATCAACGGCTGCCTGCGACAAAACACCCTTGCTTGGCAATCCTGCTGAGGTTC
CAACTCAAAGTGAATTGACGGACAATGCGACTGTTTCAGCCGCTAGTTGCGAGGTTGAAACAATCCGTGCGCCCACATTCCGAGCCCCTGACATATCCTG
ATGCAAGGACTGTGGTTCTCTTTTCTACACTGCCACTTTCTTTTCTGGGTCTCGTGCCCGTTGTCGAAAGTGAATTGATAGATAAAGGTAAAGGTGCTGC
CTTTTGCTTTTCTTCCTCTTGCTTGCCTTTCTATCTTTGTGTTACCCAAAGAACCATCGCTCGCTCATTGCTTGTTGACAAGACAAGACCAAGAGTCTGA
TAGAAACATTCGACAGGCTGTGCCTCTCTTTTCTACTTCTTGAACTCGTTCACTCATTGACAAATCTGGTTTATCATACGACAACTGCTGGACAAGTTGC
TCGTTAGTTTTTTCATCTCAACGACCATCACGATCATTTTCACCAACGCCACGCCTATTACGCCAATACCAGATTTCATTGTTACGCGACAACGCATTCA
CTCTCAACTCATCTTGAAACTCTCACACAATGGCCCACACCTCCCGCTTCGAAACTATGACTTCTCGCTTCTCACCCTCTCGTCTGCGCAACTCTCTGCG
TCGCAGCTCATCAGCCTCCACCTCCACCCAGGCTTCCTACTCATCAGTCAGCACGACAAGCTCGTCCCCTGTCGTTGCCATCAACAGCATTATCTCGCGA
CAGCCTTCTCTATTGCATCTAGAGGCTGAACGCAAGAGCTTCGGCAGTGAGTTGAGCCTGCTTGAGCCCAGGCCCATTGTCTACTGGGGCAGTGTGGAGG
AGCGCATCGGTTAATGCCTTGATACGCATACTTTGACATGAGATCTTGCTTTATGATTTACACGTCGAAGATTACAATTTCTGGGGATTTAATGTGGTGT
TGGGCTTGCCTTTTAGGTGTCTGGCAGGTCAAACTAGGGAATTTTTAAGAGACGGCGTTCGTGTGACTTACATGGTTATTCTTCAATTCTTGACCGAGTG
ACGATTCGGTATGGCATCAAAGATGAATAATCTTGCCAAATTTCAGATTCAAATTCAAACACAATCAAACTTTTAGGCCTTCATTGCTGTCTGAGACCAA
AAAGAAAAAAAAAAAAAAAACAATCCATTATCATGATCATTACATTTCATACAGTGTCATACATATCCTCGGACACGATATCAAGCAGGGGTTCGAAACG
CCTGCCACGACCCACAAACACCCCTGAAATACTTGTGTACAGAGTAACAGCGACAATGATGCCACTTTCGATCAACGCTTGAAGGCCAATGCATGATTAA
CTCATGTCTGGAGATCCGGGAGATCGCTCCTGAAGACGACGGTGCAAATGCTGCTCTTAATGTGAGACAACAATGATCACCGTTGAAATCATCAAGCGAG
ATTGCCTCTTTGCTGTTGAAGAGCAAACAAGAACCCAGATCGATAGAGACGCATGTCAGTTGGAGGGAAAATTGTACGGTGACGGTGGTAAGGTCCTTGT
CTGGAGTCAACGGTTGATACCACCCCGCGAAACAGAGAGGGTCTCTAATTCTCGGCGGAGCTTCAAGTATCATCCGCCTTCTCTCCACCCTGTCATGTTC
ACGGACCCGTAGGCGGGATCGTTTGATTCGCGGTATGAGGCTCGACAAGAGAAGCGACACCGTAATATAGACGACTCGTCAAGAACCAGACAGCACTCGT
AGCCAGAGCCAATGCCACGGCCATGAACACGAGCATGGTAGACCGCATCTGAACGCTTCGTCTGCTTCCATCTTCATGAGCTTCTTCTGTTTGCTGTGAT
AGTGCCAGCGGCCATGGGCATCATGATCGCTATGGCCAATGTGCTGGTATGGCTGGAGGAACCATCGGGGCACCCATTTCGCTTGCCGGTTACCGGTACC
GTAGAAGTTGTTGCGGCCAGCAGTATGGCGAAAGTCAACCAGGAGGAGTGAGAAGAGGAAGACGGTTATGTTGACAGGCGTCATGACGAGCTAAAAGACC
TGTGTCAGTGTTATTGTGACCAGCAGAGAATACGACCTTGTTCGTTGATATCATGAGACTTTGAAGCAAAGAAGAAGACAAGACAAGACGCTTTCTGTCT
TCTCTTGGCAACAACCACAGATAATGTCTGAACGAGGAGTGACCTACAGAATAGAGAGTAGACGGCTGGTTATTACCAGCATTCTCAGGCTGGGGACGAA
ATTTGGACAT
GATGGGAGAATGAATATGGTAGTGTATTATAACGAGTGTCGAGTTTTAAACCGTGGATGTGAGTTCAAGTTCATAACAAACAGAGATTCC
AAACACTTTGTTTCTAGGTCGTTGTTGGTATTTGATTCAAGGGCCCACCTGATCAAGTGAATCAGACAGAGAGCTTATGAATTGGTTGTGGCTCACTTAC
GTAGCCGCCCTAGTGAGGTCATCGCGTGGAGGTTGCTAGCTAATGGATGCCCGCAGGATTCCCGAAGCTCCCGATCACCAACATCAATCATCCTTGTTAC
GTATTCCTGTAATTGTTGCGGAGAAGCTCTGCATTGGATCAAGAGAAAGGCTTTTCGTCAGTTCAAACCTCTACAAATGAGCTTTTCGTCGGTTTCGCAT
ATACTATCTGAGCCATATTGTCCAGCCTCTAGCAGAATCCTCCTCAGTTCTTCTGCCAAGCCACCATCTCAAATCATTCAGCCTCATCGTGATACGACGT
ATGCAGCGTCGATCATTCCCGCCCAAGCTCCAAGTCCAGGTACCGGCAGGATCCGGCCAGGCACAATTTCCGATCTTCGCCTCATGGTGTGGGAAATGGT
CATTGAAGTTTCAATAGGGATATCCCATTACAATGGAGGTGACATGGCGTTTACATGCAGCCCATACATTACAATCCCCCTCTTTTGAGCCTGATACCAG
CCAGCCATTGATTTTCCAGAGCGCCGTTTGCCCATGAATCCCACGCCTACCGGTGCCTATGCATATCAACGCCTCCTTGCCTAACCCATCATGTATGCTC
CTTCAGCGCGCATTGTGAATGTCGAGGACAAGAATGTCCTGAGCGCCAATTCGGGTCAAATCGTCCATAACCAGAGCAATCTTCTTCTTCTCGACCATAG
AGCTGACTGCAACCCAGCCCTCCTCGTCCAGAGTGGTAACTGTCGCTGAGCGCTTCCCAGGAGTAACCTTGGTTGCCTCAGCCAAACGGCTTCGCTCGAC
ATTGTATTGGCACAGGACGTAGCTCTTGGCGGTGATAACACCACGGATACGCGAGGTGATGAGGTCGATGAGCTCAGGGTTGGAAGGCGATTTTGACTTG
ATGAGCACGGCGGTAGAGTCGACAACAGTGTCAATGGCCTTGAGCCCAGCAGCTCGCATGGTCTCTCCAGATTCTAGACGGTGATCGTTAGTTATGGTCC
GTCACAGTCGGTGAAGTAAGCCTCGAGTATTCCACATACCAACAAGGTCGACAATGCCCTCAGCAACACCAAGAGCACATGCTGCCTCGACACTTCCACT
CAACTCAACAATCTTGGTGCGCATCTTGCGAGGCGAAAGCTCTCCCTGTGCATTCTCGCCCTGCTCAAGCTTCAGGAAATAGTCGGCAGCAAGGTTGACG
AAGCTCGTCCCAATTGTCTTTCCAATGAGATCCTCGGGGGTCTTATACTGGCCCTTCTCGGGGACCTGGACCTGAAGCTTGCAGCTGCCGAAGCCCAATT
CCATAACCATATCAGAGCCAGCAACCTTATCGTCGGATGACGATAGATCAACAGAGCTACGTCGCAAGTGGTTGTAGGCACGGACTGAGGCATCATGCTC
CTGGACTTGGTCCCATCCGGTGATACCGAGGTCGCAGCGACCCTCGCCAACGAACGTGGGAATGTCGGCGGCAGGGAGGAAGATCAGGGCAATAGGGAGA
TTCTTGACGAGAGCGATATCGAGACGGTTCTCACGACGGAATTGGACGTCGGCGCCCTCGAGGAGGTTCAGTGTGGCAGCATTGAGACGACCCTCTGTGA
TGAATGAGCATAAGAATGTCGATTGGAAGGATATGAGACGACTCACTCTTGGGTACGGCAAAAAGAAGACGGCCTTCGAGACTGGAGGGGATTTTGAATC
AGCGACCACATAGTGAAGGTGGGATGTTGAGGGACGATTTTGACGTTGCGAGGCTCACAACGGGGCGGACCAACCTGTTGACGAGATCCATGGCTGGCTA
CAGAAGTGCTACAATGCAATGCTTCTTCCCTTGGACTAGGTATAGGTAGTTTGAATTAGGTAAATCACACAGCAGGGTAAGGCAGTCGGGGAATTTATTA
TTGTCTGTGGTGACTGCTAATGACTCCGACTGCGGGGCTTCAAGACGATGGCGGGGCTTCGTGTATTTGGCTGTGGTACCAGCATGCACCATTTCATACG
CTGGGGCAATGTGATTGGGGCTCTAATCAGGTACCACATAACCAAATCACCACCGACACAGACCGACCATCGGGGGGAAGATGTTGACAGGCCCACCAAT
TAGGAGACACACAGATAACACGGTGCTGAAGATAGAGTCATACATGGATGTGGATGTTTTCTGAAGTCCATATCCAATACTAAACATTTCAAGCTGCTAA
TTGAGGCCTTTGTTTTGAGAATATGCTGAAACAACGTGTACCCGAAAATGTACATAGGCTTGCAATTGACTTTGTCAATCAAACTTACTAACGACAAGAC
ATTTACAGGAACCCAATTAGGAGTGATTACAGAAAGGCATTAGAATTGCCCAACAACAAAATGTCTTGTGCACTGGATTTGTATCATGTATCATGCGGTT
GAGATTCCATCCGAAGTTAGACCGGATTGACAACGACCAGGCGAACGATAGGTGCTCGAGCCTTTATCAGGCTGAGACACAATGGTAAGGACGTTGAACA
AAGCCTTTGATTCAGACATTGCGGGTTCGAGGGCATGGAATCGATCAAGGTAGTTTCTTCATCAGGTAGAGAATGAAAACAAACCGAAGCAGCCCCAACA
GAAGTAGTTATCATACGGGGATGCAGTCATGTCATTCAGCGAGCAATGTGGCTGGCTGTGGTACTGACCGGAACAACGTTCTCCAAGCAACTTGAATAGA
AGATGGTGTGCTCGCTCAGCATGTTTTACTTGCTGTCTGTGAGTGTGGTATCATGCGGCTTGCGTTCGTTCATATGCACCTTTCTTTTCCTCGCCTGCGC
GGATGTTTGCCCGTTCATTCACCTTGTACTACACTCTCTTGGAGGTGTGCTACCTAGGTCCTTTTTCCTGTCTCGTTTCTTTTTTTCGTCCTTTTGCTGA
CGCCTACTTGATAAACCCCGATGACCCAGTCCTTGTCGAGTCTCAGTCAAGGTCTCAGTCAAGGTCTCAACCGCAACAAAGTCTTTGTCCAGTCCAGTAC
AGCTCACTCAGCCCAGCCCAGAGCTGAAGAGTCACAGGTCTTGGCTTCTCTCGCTCGCTAAGCTGCCTCAGCTACCGGTTGGTTCGGTCTAAGCCCTCTA
TGACATTTGTGTCTAATTCTCGGGGACGCCTAGATATGCTATGTCATGCCTTAACCACTGCGTCGGGATACAACAGAAATCATCGTGGAGATCAGAGTTC
ATGAGCTTGCGACCATTACGGCAATAAGTCCTGGGATAACGGAGCTGAGCCAGGGAATCGAAGCCCTTTTAGCGCTCCCGGCCCGCGCCACTTGGGAGCT
TAACCTCCAGCTCCACCTCAAACTTTCCATCAATTTACACTTTACCTTCAGCCGGGCTTCTGGGTTCTCCACCTGCCGCCGCCCGCGCGACATCGACGAC
ATAGTGCCTCCAGCGCCTAACTCGACCTAACTGACTTTGCTTTGCTTTGCTTTGCTCCGCTTCACTTACATCCTACCTTACTCTGTATCGTCGGCCTCTC
CTTTTGGTGGCTTCGCCTCCTGGCGCTTTCTGCTCCCCTCAAGACTGACATCTGGTCTTGTCTTGTTTCGCTTCTCTTCGCTCTTTGGCTTAGGACCAAC
TCCAAGGGGAATTCAGCGCAACGCAACGCAACAATTGTCGGAGCATATGCTCTTATAGCTCGCCTTGTCCGCACAGCTTCTCCTCTTCGCTTCGTCCTCC
ACAAATCATCCATCCTCTACGGATACCTACCTCCCGAACCTTTTTATTCCTTTCTATGTTATATTTATACGCAGACTTACACTCGGCACCAATTCTCGAT
AACCTTATTATCGATCGCAAACCACAATGAATTCTGCCTATCACTCGCCCGACATGTCGCAGCGAATCCCAGGCCCTGCCTATTCTTCCAGCGCACCACC
ACCACCAATTCATACCTACCAACAACACCAGCATCCTCCTCCGCCTCTACCGCCTCCGAGTCAACATCACCACTCGTCTCACCCTCCTCTACCTCCTCCG
CCGTCAGCTCCACATCCTCACCACCAACATCCACCGCCGCCGCCACCTTCCCACTCGCTATCTTCGCATCAACATCATAGCCAACCACCCCACCACCAGT
CTCAACTCCCACCATATGCACCAGCTCCATATCAACAGCCTCAGCCGAGTCAATACCCTCGGCCCCATCCGCACCAGCAACACGCCCCTTCTCCTTCGCA
ACATGATGAACCTCCTCCTCCCCCGCCTTTCTCAGGACCATCCCCTACCGACCATCAGAAAGATTCCGAATACGTTCCCCCATCTTACTCCAAGATTGAA
GAAGGATCAGGCTGGAAGTACAGGTTTGTGACCAAGGCGAATCCTTCAAACTTCCTTCGCGACCCCGCTGAAACGATTTCATAGTCTCGATGTGAAGCAA
CAACCCGTGCGTGCGCGCATGTGTGGATTTGGCGATAAGGTCTGTTTCTTTCGTTGCCATTGAGCCCTGATCATCTGTCTCACAGTTCCAATCTAGGATC
GTCGCCCAATCACGCCGCCGCCGTGTGTTCGTCTTGTCATAATAAATACTGAGACGGGTAAGGAGGTTGACTACAAGTACGTTGATGCAGTCGTGGAAAA
AAGGCACCTTGTTTTGTGCTAACACATAATGTGTAGTAGCCTGGACCACGCCATGTTTGTGTTGTCGGTCGATCTGTGGAATCATGACGGTACCAAAGAA
GTGAATCTGGTACGGTCGTCGACTGGGACCGGCGCTATGGCATCCTCAAGTACCTACACTTATTCGTCCTTAGAGCCAGGGACCCCTTCGTACCAGCAAC
AATCTCTGCCCCCGAGCCGCGAGTCTGGATATGGGCAATCGCAAGGGCTGAACTATGGGCAGGATTACCCCCCACCGGTGCAGCAAAGCTACGGGCAAGG
TTGGTCGAAACAGGAGGAACAAAAAGCGAGGACAAATCCGTGTCTGACATAAGAGTAGCACCGTCGTACCCGCCGAGCAGTTCCTACGGTCCGCCCCAAC
AATACTACCCGCGACATAGCGGTTACAGTGCCGAACCTTCCGCTCCTCCGCCAGGCGCCCCTTTCCGTAATGGATATGGACAGGATCAAAATGCGCTTAC
TCGGATGGCAGTGGTTGGGGGGCAACCCCAAGGGATGTTTACGAGAAACTTGATTGGCAGTTTGGCCGCAAGCGCATTCCGTCTCGAGGACACTGAAGGA
CAATCAGGTATCTGGTTTGTCCTCCAAGACCTCAGCGTCCGTACTGAAGGAACCTTTCGGTAAGAGCAACTGAATTTGGTCTGTGCCGTGGCTCGTGATT
GCTGACGCTGAAGTTGCAGATTAAGGTTCTCCTTCGTCAACGTTGGACGCCCCGGAGGGCAGGGAACCAACGTAAACCAAGGCCGAGCGCCAATCCTGTC
GTCGTGCTACAGCGAGAGTTTCCACGTGTACTCGGCCAAGAAGTTCCCCGGCGTGTGCGAAAGTACACCATTGAGCAAGAAATTTGCGAACCAAGGCATC
AAGATCCCGATCCGTAAGGACGCCAACATCAAGGGCGAAGGTGATGAAGAGATGTACGATCAGAACTGAAGGATCTGCGTGAACTATATCGCCAAAGAAA
TATTCATGATTGTTTGACCATATCAGAGATGGGCTTCGGAAATTGGCTATTCAGATAGTTGAAATCCGCAAGAGAAGGAATAGCTGGCGCACACAAGAGG
CATTCGGCACTGGAAAATAGACCAAATCATGACTCTCCTCTGTACAAGGTTCCAAGATATGTCGCCAAAATGTATAGAGGTACTGCCCTTGTTAGACAAG
GCACCATGTCATTGAATACTGAGCATAGATGCTGGCGTTGGTGTTTGGAATTGAGTCGATTTCTCATGCTTTTATGCTTTTGTCCTAGCTTGCAATACAG
TGTGTCGGGTGATGTTGCAGTTCGACACATCTAAAGAGCCAACAAAGAGTGTGAAGCCAAGTGTGGGATCGACAGGGCAAAGGGTTCCCTAGCCCGAGAG
CAAAAGATGACTGTATCATGACCAAACCCGGGGTTCAAGGAGTCAACGTCATCGCACTTAGACAAGCTTAGCCGCCAATTTCAGGGTCTTGGGTCTGATT
AGCATGGAACAACCCTGATGGAATCTAGCTACAAGCTACAGGCTACAAGCCACAAACAGCAGCATCCCTTGCACATTTCGAGATTTTGAGGTCATGAGGC
TTGTGATTGAATGCCTTTTCGAGAAGCTGGGGGGTCTTCCCAGCTTCCATGGCTATGAGCCACCAAGCCAGACCAGCCCGCCGTGTCGGGGCACGCCAGT
ACAGAAACGGCTATGGATAAGCGCTGGTACCGGCACGCAAGAATATGAGAGTTTACGCCTTATGCGGGAGCGAGCGCCGCTGGGAACTCGGAGCCCGGCG
AGAGCGAAGACGATCTATGGATCTCTGAATAGATTCTCTTGGCGGCGAGAGGCCATTCGGCTAACTTACTTTCTACTTGACCGAACAGCGAGACCTTGAA
AGGGGAGGATCTCATGGAAGACTTGTGTTGTCATGACAGAGATGCCTCTCACACCTGACGTGGTTGGCGCACAACTCACGGAGAATTTTGATATTCCCAT
TTGAAGACCGCCTAAGGAACTCATCTTTCAGTGCCTACGCGCTTTTGCAACTATTGGCTCGATATATGAGCTTTCCCCTTTCGGTCCCTGAGTGAGGAGC
GAGTACAGCATCCTCATAACTCGGTTTCAATTTATGGCTGACGGGCATCAAGTGACCCAGGCTCTCAGCATTGAACCCCTCATGGCCTCATGAAAGCTTG
TATTGATTTCGTATATCGGAAGTACCATGCCAAGATCTGGGGCAGCACGAGGCCATCAAAATTCATTACGCAACCAATTTCTATGACTGGGCATGGCCTC
TTAGTGCCATGACCAAGTGGAACTGGCGCACGGGTACTTGCGTCTACTTGTCCTAGACTTGGGCGAGCTTTAACTGAGCCTCATTCTTCAAATGGAGAAG
GGTTGAGAGGAGGAAAGCGCTTTTCAACTAGAGTTTGAAAGAGAGAATTCGATCATTTGACTCAAGGATAGACTCCAAGATAGTGCAGAAGAAGCACTTA
CAGCTACAACGCCCAGCTGAAGAGATCTCGCCCTACAGCTCACAACCCAGTAGCCCAGGTTCGGGGCAGCCTAGTGAGCACAAGGCCAGTCTAGGCCATA
TACTCTATGGCTGGGCACAGTGGTTCGGTGGGTGTGAAGAAAAAAAAAAGGCCGCAGCGCCTAGGAACCTATCGAATTTTTTCTCTCTTTCCCCTGTTTA
GTTGATCATGGGAACACTTCCAGGGCAGGGGAAAATTTGGTAGCAAGTTACAACATCAATCACGAGGACTTGGCATTGAGTTAAAAACTGTCACCACCGC
CTCCAGCTAAATCTCCTTCACTCAAATAGACTTTTCTCTTCATCATTACAATTCCTTAGAGACGTACTCCTGATCGTTTGACTTGACAACTTCTCAGTCT
ACTCAACAACTCCTGGACAGTCACTAGTTTAGTTGTTAGTCACCCAAGAAGACGGCAACTACACAACTACCCCTCAACGAACAACAACACTTTCTCTTCC
AAACTCACACAGCTGTCACAATGCTCTCCTCTCACGGTCGAGGTGGTGCTGGCAACATGGCCGACTCAACCCACACTGAGAAGACAGATCCCAGCAAGCT
CCAGACTCCCGTCCTCAAGGGCTCTGTTGTCACCACCGGTCGTGGTGGTACAGGCAACATGGCCAAGAACGATGACCCTCGCGAAACTCGCAAGCGTCAG
GACGTTGAAGCGTAAGTTTTTTATCCCTCCTGCCACTCAATCTCGGGGATCATTCTCTTTAGAATCGTTGCTGACCTGAGACAAAAGTATCCCTCGACGC
CCCTCATCTGGCGCTCAGCATGCTGGCCGTGGTGGCGCGGGCAACGTCTTCAAGGACAAGGAGACAGAGTTGACCCGCAAGCCCAGCAACGATGAAGCTA
TCACTGACGAGGAGGAGCCCAAGTCTGCCAACTCACCTACTGCTGCTGGCGCGTCGTTGGCTCAGAAGGGCAAGAACTGGCTCTTTGGCAAGAAGGCTTA
GGACTTCAGAGACATTCAAGTGTTTCACCATGCTCAATTCTAGAGATGAGAGATTTCATGTTCTACTGCTATTGGGTCTAGTTATTTTACAGTACAGCTT
GGTGTTTTGGCGTCTTTGACATTGAATCTGAGGCAGGGGTTCTGGCTAAACAATCTTATGAAGGACGGGTCAACGTACAGGACAAAGGATACGTGAAAAG
GAGGAAAAGCAAAAGTAAAGATACCATCCCATGAATTAAATGATTTACAAACAAAGAGTTATTTTTCTCAGTTCCTTGGCCATGCTATTTTACTATGTTA
CATTTTTGTGTCTACTGGTATTCTCCACAATGCTTTTTCTTATGCCCTCTCTTATTTACTTTGATGTTCAACCCAGCATAGACACATGGTATCTCAAAAT
ACGCCTTCAACACAGCACACACTGATATTTGACCATTAGTTCTTCTTGGTCAAACGGTGAATCTCCTCGAAGTAGTGCTTGAGATGATCAGGGTTTACGC
CAGGTGTAATTCCTGCCTTTGGTCAGCCCCTCGTCCAGCTCAGTGTCATGTCACAGAGAACTTACCGTGGCCAAGGTTGGCAATCCAGCCCTTGTTTCCG
ACCCAGAAGCCTTCTACCATCTCCTCCACGGCCTTGGTGATAGCCTCCTTGGTGCCATACAATACCCCTGGGTCAGCATTGCCCTGGAACACAATGTTGC
GGTCGCCTCGAATCTTGACAGCCTCCTTGGGATCATGCAACCAGTCCATGCCAACCACATTATAACCCAGGTTGCAGGCAGAGTCGAGTGCGTACCAAGC
ACCCTTGGGAACACAGTCATGGGAACCTTCTCCAAGCCGAGGCTCTGGAGCTTGGCGGGAAGCTTCTCGGCGATTTGCTTCAAGTAGGGCTCGGAGAATT
GACGGTAAGAAGAAGGGCCGAGCTCTCCTGCCCAGGAGTCAAAGACCATCACTAGCTATAAAGTTTGCAAGTTAGTCATATATGGTGCAGTTCTAGAGGG
GAGCATTCTATACCTGAGCACCAGCCTTGACTTGAAGTGCCAGATGATCCACGCAGATATCGGCAATCTTGGCCAAAAGCTTCTTCGACTCCTCAGGATA
CTTGTAGATCCATGTCTTGACCTGCGCAAACAGCTTGGTGCCACCACCCTCGACCATGTAGCAGAACAGCGTCCAGGGAGCGCCGCAGAAGCCAATCAAG
GGCACCTGTCCCTCAAGCTTCTGGCGTGTTAGTGTGATAGCGTCGTACACGTAGCCGAGTTCAGCAGCAACATCGACGTTCTTAGCGAGCACCTGGCCGT
ACTGTCCGTCGTCGGGGTTCTGGAGCGGGTTCGGGAAGTGAGGGCCCTTCTTCTCAACCATCTCAACGGTCATACCCATTGCCTGGGGAATGACAAGAAT
GTCGGAGAAGATGATGGCGGCATCGATGAGACCTGCGAATCGGCGAACAGGCTGGAGGGTGATTTCGGTTGCGACTTCAGGGTCGCGGCAGCATTCGAAG
AAGTCTCGGTTACCCTTGGCTTCGTGATACTCCGGTAGGTAGCGACCGGCTATCAATTGATCAGGTCAGTCTTGTGTGCTTTTACCCGTAGGTCGGGGTA
CCTTCTCACCCTGTCGCATCACCCACATAGGAGGGCGTTCAACGGTCTGACCTAAGTTGCAACACAGCAAGTCTCAGCACAGTTCTCTCTCATGATTCTC

Favorite :